KEGG   Pantoea ananatis PA13: PAGR_g3726Help
Entry
PAGR_g3726        CDS       T01970                                 

Definition
dihydropteroate synthase FolP
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
paq  Pantoea ananatis PA13
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAGR_g3726
Enzymes [BR:paq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PAGR_g3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4058285..4059118)
Genome map
AA seq 277 aa AA seqDB search
MKLFARDSHLDLSFPHVMGILNVTPDSFSDGGKHNALVDALTHTNEMVNAGATIIDVGGE
STRPGADEVSVEQELERVIPVVAAIAQRFEVWISVDTSKAEVIREAASVGAHIINDVRSL
SEPGALAAAAATGLPVCLMHMKGDPRTMQQAPAYQDIVSEVDAYFVEQLARCEAAGIKKE
NLLLDPGFGFGKNLSHNYELLARLSEFHHFGLPLLVGMSRKSMIGQLLNVGPGQRLTGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATQRAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttcgcccgtgattcccatcttgatttgtcgtttccacatgtgatgggcatt
cttaacgtcacgccggactctttttcggatggtggtaaacacaatgcgttggtggatgca
ctcacgcataccaatgaaatggtgaatgccggcgcaaccattatcgacgtgggcggcgag
tctacgcgtcccggcgcggatgaggtcagcgttgagcaagaacttgagcgggtcatcccc
gtggtggcagcaatcgctcagcgctttgaagtctggatctccgtggatacctctaaggct
gaggtcatcagggaagcggcgagcgtgggggcacacatcatcaatgacgtgcgctctctg
tctgaaccaggagcgctggccgccgccgccgcgactggcttgccggtatgcctgatgcat
atgaagggcgatccacgcaccatgcagcaggcaccggcctatcaagatatcgtcagcgaa
gtggatgcttacttcgttgagcaactggcccgctgcgaggcggccggaataaaaaaagag
aatctgctgctcgacccgggcttcggtttcggtaagaatctcagccacaattatgaactg
ttggctcgactcagcgaatttcaccattttggtctgcccctgctggttggcatgtcacga
aaatcaatgattggtcagttgctgaatgtcgggcctggccagcgtctgaccggcagcctg
gcctgcgcggtgatcgccgccatgcagggagcacacattattcgcgttcatgatgtaaaa
gaaacggtcgaggcgatgcgggtggtcgaggcgacacaaagagctaaaggatga

DBGET integrated database retrieval system