KEGG   Pantoea ananatis PA13: PAGR_g3822Help
Entry
PAGR_g3822        CDS       T01970                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
paq  Pantoea ananatis PA13
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAGR_g3822
Enzymes [BR:paq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PAGR_g3822
Peptidases [BR:paq01002]
 Cysteine Peptidases
  Family C44
   PAGR_g3822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4152738..4154576
Genome map
AA seq 612 aa AA seqDB search
MCGIAGWSAFDNDLRAQSAIIDAMADSLSSRGPDERGIWLDKHIALGHRRLSILDLAHGQ
QPMFFYEAGKPVLAMVFCGEIYNFQSLRGMLEKESYSFRTRSDSEVLLSLYHRYRDEMFP
LLQGMFAVAIWDIPQNELTLGRDRLGIKPLNYVLKDQQIIFGSEPKALLCNPHCERMTGP
DELCEILDMVKTPGKTPYKDMKELRPGEILKFSRHGARSSQYWNLCTAPHTDNQKLTCDK
VTALLEESIRSHLVSDVPISSLLSGGLDSSIIAVQGSRHLPGQLLTFSMDFTRNLSAFRA
DAVRSSPDELYARELAAFAGTAHESVLLNTEEIAAASVRDRVLEAVDSPPAYWGDMWPSM
YLLFRRIKEKSSVALSGEGADELFGGYRWFHNPAAIASETFPWLTPGSSRYFGGSGLFNE
EFLNSLRMEEYRRARYEEAVREVTYLPGESDDEKAMRRINYLNITRFLQTLLDRNDRMSM
AAGVEVRVPFCDHRLVEYVYNIPWSMKNTRTQEKGLLRDATRQWLPADINERVKTPYPST
QDGAYEVLLRNELRRIIEDRNSPIHPYLNTERVIKNSQRKASELSLPYNRGSMEMVISMN
NWLRRYRVSIAI
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgccggctggtcagcattcgacaatgacttacgagcgcagagcgccatt
attgacgcaatggcagattccttgtcatcgcgtggtccggatgagcgaggaatatggctt
gataaacatattgcgcttggccatcggcggctgtcgatcctcgacctggcacatggccag
cagcccatgtttttttatgaagcaggcaagcctgttcttgcaatggtattctgcggcgaa
atctataattttcagtcgttacgcggcatgctggaaaaagagagttactcattccgcacc
cgctcggacagtgaggtactactttctctctatcaccgttatcgggatgagatgtttccc
ttattgcaaggcatgtttgcagtagcaatctgggacatcccccagaatgaactgacgtta
gggcgggaccgtcttggcatcaaacccctcaactatgttctcaaagatcagcaaatcatc
tttggttctgaaccgaaagctctgctctgtaaccctcattgcgagcggatgacgggtccc
gatgagttgtgtgaaattctggatatggtaaaaacgcccgggaaaacaccctacaaggat
atgaaggaactacgtcccggtgaaatacttaaattcagtaggcacggtgcccgcagcagt
cagtactggaacctttgcactgctcctcatacggataatcagaaactcacgtgtgacaag
gttacagcactgcttgaggagtctattcgatctcacttagtttcagatgtacctatcagc
tcgctgctgtcaggtggactcgactcatcgataattgcggtacaaggaagccggcatctg
cccggacagctgcttactttctcaatggacttcactcgcaacctgtctgcgttcagagcg
gatgctgtccgttcatcgcctgatgaattgtatgcgcgagagcttgccgcgttcgcgggt
acggcacatgaatccgtactgcttaatacagaagaaatagcggccgcctctgttcgtgat
cgggtgctggaggccgtcgactcaccgccagcttactggggtgatatgtggccatcaatg
tatctgctctttcgtcgcattaaagagaaatccagcgtggcattatccggggagggggca
gatgagctctttggaggataccgctggtttcataacccagccgccattgcctcagagacc
ttcccatggctcacgcctggctcgtcacgatactttggtggctcgggattgtttaacgag
gagtttctaaatagcctccggatggaggagtatcgtagagcccgctatgaagaagctgtg
agagaagtaacctatttgcctggtgaatctgatgacgaaaaagcaatgcgccgaatcaat
tatctcaatatcacccgctttcttcagacgctgcttgatcgcaatgaccgtatgagtatg
gccgccggtgtggaagttagagttccattctgtgaccaccgcttggtggagtatgtttac
aatattccctggagtatgaagaacacgcgcacacaggaaaaagggttgctgagagatgcc
acccggcagtggctgcccgcggatatcaatgaacgggttaaaacgccttatccttccact
caggacggcgcttacgaagttctgctgagaaatgaattaaggcggataatcgaggatcgc
aacagtcccattcatccttatttaaatactgagcgagtgataaaaaacagccaacgtaag
gcatcagaactgagcctcccttacaacagaggaagcatggaaatggtgatttcgatgaat
aactggctcaggcgttacagagtaagtattgcaatataa

DBGET integrated database retrieval system