KEGG   Pantoea ananatis PA13: PAGR_g3902Help
Entry
PAGR_g3902        CDS       T01970                                 

Definition
exoglucanase/xylanase Cex
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
paq  Pantoea ananatis PA13
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4236090..4237349)
Genome map
AA seq 419 aa AA seqDB search
MQRIAADGEVVWRYKKAGAGPTWPEYCPLESGGIVALRLTDTVFSSTSTSTSTSTSPCRR
RFLKSSAALMLAGALPLPVLASIPPFPALKTVAAQSHRLFGFAVGPDSLQSDAHYRQFVA
SQASIIVPENALKWMAVHPARDRYDFAGPDAIAAFAREQGIRLRGHTFCWHRALPDWVQA
IADKAELEKVLRQHIATVAGRYRGQIHSWDVANEIINLADGQPGGWRNSFWYQRLGTRYM
DIACEALHQADPHAVICYNDYGLESDDVSGQRKRAAVLAMLRDLQSRHIPIGALGIQSHL
KAGPHPAFGPGLAAFIRDVKSLGLKVYITELDVDDSSVPMESRPMAVAALYKRYLSLVLE
AGVAAILTWGVWDTPHRTAATPKAGDALATGPLLFGKDGSIKEASWAALHALRSSPDLR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatcgcggcagacggcgaggtcgtttggcgctataaaaaagcaggggccggg
ccaacgtggccggaatattgcccactggaatccggaggcatcgtggcgctacgtcttacc
gataccgtctttagctcaacctcaacctcaacctcaacctcaacctcgccatgccgacgc
cggtttctgaaaagcagcgcggcgctgatgctggcgggcgcgctgccgttgccggttctg
gcatccatcccaccttttcccgcccttaaaaccgttgcggcgcaaagtcatcggctgttt
ggctttgccgtcgggcccgacagtctgcaatccgatgcgcactatcggcagtttgtggcg
agtcaggcgagcattatcgtgccggaaaatgcgctgaaatggatggccgtccatcccgcg
cgcgatcgctacgatttcgccgggcccgatgcgatcgccgcctttgcccgcgagcagggg
ataaggcttcgcgggcatacgttttgctggcaccgcgccctgccggactgggtacaggct
attgctgataaggctgagctggagaaagttttgaggcagcatatagcgaccgttgcgggc
cgctaccgcgggcagattcacagttgggacgtggcaaacgaaatcatcaatctcgccgac
ggacaacctggtggatggcgcaacagtttctggtatcagcggcttggtacgcgttatatg
gatattgcctgcgaggcgctgcaccaggccgatccccatgcggtcatctgttacaacgat
tacgggctggaaagtgacgatgtgagtgggcaaaggaaacgggcggcggtactggcgatg
ctgcgcgacttgcagtccagacatattccgattggcgcgctcggcatccagtctcatctc
aaagccgggcctcatcccgcctttgggccggggctggcggcatttattcgcgacgtgaaa
tcgcttggcctgaaggtgtacatcaccgaactggacgtggatgacagcagcgtgccgatg
gagagccggccgatggcggttgccgcgctgtataaacgctatctttcactggttctggag
gcgggcgttgccgccattttaacgtggggcgtttgggatacgccgcaccgcacggctgcg
acaccgaaggcgggggacgcgctggcgaccgggccgctgctgtttggtaaagacggcagc
attaaagaggccagttgggcggcgctgcacgcgctccgctcatcaccggatctcagatga

DBGET integrated database retrieval system