KEGG   Pantoea ananatis PA13: PAGR_g3983Help
Entry
PAGR_g3983        CDS       T01970                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00010  Glycolysis / Gluconeogenesis
paq00620  Pyruvate metabolism
paq00640  Propanoate metabolism
paq00680  Methane metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g3983
   00620 Pyruvate metabolism
    PAGR_g3983
   00640 Propanoate metabolism
    PAGR_g3983
  Energy metabolism
   00680 Methane metabolism
    PAGR_g3983
Enzymes [BR:paq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAGR_g3983
Lipid biosynthesis proteins [BR:paq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAGR_g3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AER34468
Position
4332387..4334342
Genome map
AA seq 651 aa AA seqDB search
MSQHHIYPVPENIAANALITAEQYQAMYQQSVTDPETFWGEQGKILDWIKPYSKVKNTSF
APGNISIRWYEDGTLNLAANCLDRHLATRGDHPAIIWEGDDANESKTITFRQLHADVCRF
ANVLELLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRVIDSSA
ALIVTADEGVRAGRTIPLKKNVDDALKNPNVNSVKNVVVFQRTGKDVGWVEGRDRHWHEL
MQNASTNHSAAEMQAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKFVFDYHQDDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTSARMAQVVDKHKVTLLYTAPTA
IRALMAEGDKAIEGTDRSSLRIMGSVGEPINPEAWEWYHKKIGNSQCPIVDTWWQTETGG
FMITPLPGATRLKAGSATTPFFGVQPALVDNEGHPQEGACEGNLVITDSWPGQARTLFGD
HDRFEQTYFSTFKNAYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHSIKGQAIYAYITLNHGEEPSPELYTEVRNWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSITMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacatcatatctatcctgttccagaaaatattgcagcaaacgcgctgattact
gccgaacagtatcaggcgatgtaccagcaatcggttaccgatccagaaacattctggggg
gagcaaggtaaaatccttgactggataaagccttacagcaaagttaaaaacacgtctttt
gcgcctggcaatatttccattcgttggtatgaggacggcacgctcaatctggcggcgaac
tgcctggatcgtcacctggcaacccggggcgatcatcctgccatcatctgggaaggtgat
gatgccaacgaaagcaaaacaataacctttcgtcagcttcacgccgatgtctgtcgcttt
gccaacgtgctggagctgctcggggttaaaaaaggcgatgtcgtcgcgatttatatgcca
atggtgccggaagccgcggtcgccatgctggcctgcgcgcgcattggcgccgtgcattcg
gttatttttggcggcttttcaccggaagcggtggcaggtcgcgtgatcgactccagtgca
gccttaattgtgacagccgatgaaggcgtgcgcgcggggcgtacgatcccactgaaaaaa
aatgtggatgatgcgttaaaaaatcccaacgtaaacagcgtgaaaaacgtcgtggtcttt
caacgtactggcaaagacgtcggttgggttgaaggacgtgacaggcactggcacgagctg
atgcagaacgccagtaccaaccactctgcggcagaaatgcaggcagaagatccgctgttt
atcctgtatacctcaggttcaaccggcaagccgaaaggcgtgctgcatacgaccggcggc
tatctggtttacgctgcgaccacctttaagtttgtttttgactaccatcaggacgatatc
tactggtgtacggctgacgtaggctgggttaccggccacagctatctgctgtatggcccg
ctggcctgcggtgccacgacgctgatgtttgaaggcgtgcccaactggccgacgtccgcc
cgcatggcgcaggtggtggataagcataaagtcaccctgctctataccgcgcccacggct
atccgcgcgctgatggccgaaggggacaaggcgattgaaggcaccgaccgtagcagtctg
cgtattatgggttcggtcggtgagccgattaatccggaagcctgggagtggtatcacaaa
aaaatcggcaacagccagtgtccaatagtggatacctggtggcagaccgaaaccgggggg
tttatgatcaccccgctacccggcgcaacgcggcttaaggccggttctgcgaccacgcct
ttctttggcgtacagcccgcgctggtcgataatgaggggcatcctcaggaaggagcctgc
gaaggtaacctggttatcactgattcctggccaggccaggcccgaacgctgttcggcgat
cacgaccgtttcgaacaaacctatttctctaccttcaaaaatgcctactttagcggtgac
ggcgcgcgacgggatgaggacggttattactggatcaccggccgcgtggatgatgtgctg
aatgtgtcagggcatcgtctgggcacggcagaaatcgaatcggccctggtttcccaccct
aaaattgccgaagccgctgtggtggggatcccgcacagcattaagggccaggcgatttac
gcctatatcaccctgaatcacggcgaggagccctcaccagagctttacaccgaagtgcgt
aactgggtacgcaaagaaattggcccgatcgccacgcccgatgtgctgcactggaccgac
tctctgcccaaaacccgctccggtaaaatcatgcgccgtatcctgcggaaaatcgccgcg
ggtgataccagtaatttaggcgatacgtcaacgctggccgatcctggcgtcgttgagaaa
ctgcttgaagagaaacagtccatcaccatgccgtaa

DBGET integrated database retrieval system