KEGG   Pantoea ananatis PA13: PAGR_g4042Help
Entry
PAGR_g4042        CDS       T01970                                 

Definition
malate synthase A AceB
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
paq  Pantoea ananatis PA13
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAGR_g4042
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAGR_g4042
   00630 Glyoxylate and dicarboxylate metabolism
    PAGR_g4042
Enzymes [BR:paq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PAGR_g4042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4401898..4403496)
Genome map
AA seq 532 aa AA seqDB search
MTDSVINSELLFSKPFSDAEKQLLTPDAIAFLQELVTRFAPQRERLLAARQVRQKEYDSG
GLPDFDMETVSIRERAWTIRGIPADLQDRRVEITGPPDRKMVINALNANVKVFMADFEDS
LAPCWEKLIDGQQTLREAVAGTLRYTSENGKIYQLRADPAVLMCRVRGLHLSEKHVSWQG
NAIPGGLFDFALYFFHNAEALLAKGSGPYFYLPKTESWQEVAWWRDIFSFAEDRFDLARG
TIKATVLIETLPAVFQMNEILWNLRDHIVGLNCGRWDYIFSYIKTLREHADRILPDRQSV
TMAQPFLDAYSRLLIQTCHRRGAFAMGGMSALIPSKDSARNEWVLQRVTEDKQREANNGH
DGTWIAHPGLADTAMSVFNQVLGERPNQLNILRQDDSPITAEQLLAPCEGDRTEAGMRAN
IRVALQYLEAWISGNGCVPIDGLMEDAATAEIARTSIWQWIRHQKSLLDGQPVTAALFQQ
LLNDELQTLQMHLGDKTFSSGRYEEAARLMAQITTQDELVSFLTLPGYRLLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcggttatcaacagtgaattacttttcagtaaaccctttagcgatgcggaa
aagcagttgcttactcccgacgccatcgcttttctgcaggaactggtgacgcgttttgca
ccccagcgtgagagattgttagccgcacgtcaggtccggcaaaaagagtacgattccggc
gggttacctgactttgatatggaaacggtttccataagagagcgagcgtggacgatccgt
ggtattccggccgatttacaggatcgtcgcgttgagatcaccggtccgcccgatcgcaaa
atggtgattaacgccttgaatgctaacgtaaaggtgtttatggccgactttgaggactcg
ctggcaccttgctgggaaaaactcattgacggacagcaaaccttacgggaagccgtggcg
ggaacgctgcgctataccagcgagaacggaaaaatctatcagctacgggccgatcctgcg
gtattgatgtgccgggtacgtggactgcatctgtctgaaaaacatgttagctggcagggc
aatgcgattcccggtggtctgtttgattttgctctctacttttttcataacgcggaagcc
ttactggcaaaaggcagtggcccctatttttatctgcctaaaactgagagctggcaggaa
gttgcgtggtggcgggatatctttagctttgccgaggatcgttttgatctggctcgcggc
accataaaagccaccgtattgatcgaaacgctaccggcggtattccagatgaacgagatc
ctgtggaatctgcgggatcatatcgtggggctgaactgcggccgctgggattatattttc
agctatatcaaaacgctgcgcgaacatgccgatcggattctgcccgaccggcagtctgta
accatggctcagccctttctggatgcttactcacgactgctgatccaaacctgccatcgc
cgcggtgcttttgccatgggcgggatgtcagcactgatacccagcaaggacagcgcgcgc
aatgaatgggtgctgcagcgcgtcactgaagataaacagcgtgaagccaacaacggacat
gacggtacctggatagcgcatcccggcctggcagacactgcgatgtcagtcttcaaccag
gtactgggtgaacgccccaatcagctcaacattctgcggcaggatgacagccctataacg
gcagagcagcttctggcaccctgcgaaggcgatcgaacggaagcgggcatgcgcgccaat
attcgggtggcgttgcagtatctggaagcctggattagcggcaatggctgtgtccccatc
gatggcctgatggaagatgccgcaactgcagaaattgcccggacttcaatctggcaatgg
atccgccatcagaaatctctgctcgatggacagccggtcacggccgcgctcttccagcag
ctgctgaacgatgagctgcaaacgctacagatgcatctgggcgataagacattcagttca
ggtcgttatgaggaagcggcgcgcctgatggcgcagatcacaactcaggacgaactggtt
tcctttctgactctgccaggctaccgcctgcttccctga

DBGET integrated database retrieval system