KEGG   Pantoea ananatis PA13: PAGR_g4098Help
Entry
PAGR_g4098        CDS       T01970                                 

Definition
lysophospholipase L2 PldB
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:paq00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4478863..4479855)
Genome map
AA seq 330 aa AA seqDB search
MKQHRASWLQREKAFAAFATGPLLDFWHSREECEFTGVENLTLRYVRFISPQHKRVIVIV
PGRIESYVKYPELAYDLFHCGFDVIVLDHRGQGRSDRLLDDSHLGHVVEFSHYVDDLETL
YLKEIVSRHYQQRYALAHSMGGAILALFLARQPGAFHAAALVAPMFGIALPLPSFLAHKI
LDWAEKRPAVRDGYALGTGRWRAHPFGINRLTHSHERYRRSLRFYADDPAIRVGGPTYHW
VREGIHAGRNIFSQVDKITTPLLLLQASEDSVVDNRSQDLFCAAMAAAGHPCEGDKPQVI
KGARHEILFEKDSMRAEALNGIVDFFLSHH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacacagagcaagctggctgcaacgcgaaaaggccttcgctgccttcgcgacc
ggcccactgcttgatttctggcacagccgtgaagagtgtgaatttaccggcgttgagaat
ctgaccttacgttacgttcggttcatttcaccgcaacacaagcgcgtgattgtaatcgtt
cccgggcgcattgagagctacgttaaatatcccgagctggcctacgatctgtttcactgt
gggttcgatgtgatcgtgctcgatcaccgtggtcaggggcgatccgatcggctgctggat
gattcgcaccttggtcatgtggtggagttttcccactatgtcgatgaccttgaaacgctc
tatctgaaagagattgtgagccgtcattatcaacaacgttatgcgttggcgcattcaatg
gggggcgcaattctggccctgttcctggcgcgtcagcctggcgcgtttcacgctgcggct
ctggttgcgccgatgtttggcatcgcgctgccgttaccctcttttctggcgcataagatc
ctcgactgggcagagaaacgacctgccgttcgcgatggctatgcattaggcacggggcgc
tggcgggctcatccctttggcattaaccgtctgacgcacagtcatgaacgttatcgtcgc
agcctgcgtttttatgcggacgacccggcgattcgtgttggcggtcccacctatcactgg
gtacgggaaggcattcatgccggacgcaacatattcagtcaggttgataagataacgacg
ccgctactgctacttcaggcaagcgaagacagcgtggtggataaccgctcacaagatctg
ttttgcgccgccatggcggcagccggtcatccctgtgagggcgataagccccaggttatt
aaaggtgcacgccacgagattctgtttgaaaaagacagcatgcgcgccgaagcattgaat
gggatcgtcgatttctttttatcgcatcactag

DBGET integrated database retrieval system