KEGG   Pantoea ananatis PA13: PAGR_g4102Help
Entry
PAGR_g4102        CDS       T01970                                 

Definition
(GenBank) outer membrane phospholipase A PldA
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00564  Glycerophospholipid metabolism
paq00565  Ether lipid metabolism
paq00590  Arachidonic acid metabolism
paq00592  alpha-Linolenic acid metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAGR_g4102
   00565 Ether lipid metabolism
    PAGR_g4102
   00590 Arachidonic acid metabolism
    PAGR_g4102
   00591 Linoleic acid metabolism
    PAGR_g4102
   00592 alpha-Linolenic acid metabolism
    PAGR_g4102
Enzymes [BR:paq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PAGR_g4102
    3.1.1.32  phospholipase A1
     PAGR_g4102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AER34587
Position
complement(4483155..4484030)
Genome map
AA seq 291 aa AA seqDB search
MRKHRALLAAMLLPALAQADEATIKHVHDAPQVRGSIIANLLEQHDNPFVLYPYENNYLL
YTYTSDINKEAISSYNWAQNARKDEVKFQLSLAFPLWRGILGDNSVLAASYTQRSWWQLS
NKKESSPFRETNYEPQIFLGWATDYSFAGWTLRDVEVGVNHQSNGRSDPTSRSWNRVYTR
LMAQNGNFLAEIKPWFRISESASTDDNPDITKYMGYYRAKVGYAMGDSIFSVEGNYNWNS
GYGGATLGWSYPITQHVRFYTQLFSGYGESLIDYNHRQTRLGVGVTLNDLF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagcatcgcgccttgctggcggcaatgttacttcctgctttggcgcaggcggac
gaagccacgatcaaacacgttcacgatgcaccccaggttcgtggcagcattattgccaac
ctgctggagcagcatgacaacccgtttgtgctttatccttacgaaaataactatctgctt
tacacgtacaccagcgacattaataaagaggcgatttcctcttataactgggcgcagaat
gcccgtaaagacgaagtgaaattccagcttagtctggcatttccactgtggcgcggcatc
ctgggtgacaactccgtgttagccgcgtcctatactcagcgctcatggtggcagctatcc
aataaaaaagagtcgtcgcccttccgcgagacaaactatgagccgcagattttcctgggc
tgggcgaccgattattcgtttgccggctggacgctacgtgatgttgaagtgggcgtgaat
catcagtccaatggccgtagcgatcccacgtcacgcagctggaaccgtgtttatacccgc
ctgatggcgcaaaacggtaatttcctcgcagagatcaaaccctggttccgtatttctgag
agcgccagcacggacgataacccggatattacaaaatacatgggctactatcgggcgaaa
gtgggctatgcgatgggtgacagcattttcagcgtggaaggcaactataactggaatagc
ggttacggcggcgctacgctgggctggagttatcccatcacccagcacgtgcgtttttac
acccagctgtttagcggctatggtgaatctctcattgactataaccaccgtcagactcgt
ttaggcgtaggtgtgacccttaacgatttgttctaa

DBGET integrated database retrieval system