KEGG   Pantoea ananatis PA13: PAGR_g4117Help
Entry
PAGR_g4117        CDS       T01970                                 

Definition
uroporphyrinogen-III synthase HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
paq  Pantoea ananatis PA13
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAGR_g4117
Enzymes [BR:paq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAGR_g4117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4498769..4499497
Genome map
AA seq 242 aa AA seqDB search
MTILVTRPEPAAAELVSRLHAQGKQAWSLPLIEFAPGNDLLQLPATLATLKRGDLVFLLS
QQVIHFAQHAIKAWPADVDYYAIGRSTALAFHTISGLQVTYPHAHETSEELIKLATLQQI
AGKHALILRGNQGRELLSKTLAARGAQVTYAECYQRCQKHYDGAIEGRRWRDRNIHTLVV
TSGEMLHQLYSLFPEVDREEWLLRCRLVVVSERLASLAADLGWQTIQVADGADNDALLRT
LC
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtgacgcgcccggaacccgcagcggcggagttggtctcgcgcctgcac
gcccagggtaaacaggcgtggagcctgccgctgatagaattcgcgccgggtaacgatctc
ctgcagttaccggccacccttgccacgttgaaacgcggcgatctcgttttcctcctttcg
cagcaggttattcactttgcacagcacgccatcaaagcatggcccgctgacgtagactat
tatgcaattggtcgcagcaccgctttggcttttcatacgatcagcggcctgcaggtgacc
taccctcacgcgcatgaaaccagcgaagagttgataaaactggcgacattgcagcaaata
gcgggtaagcatgcgcttatccttcgagggaatcagggccgcgagctgctgtcaaaaacg
ctggcggcacgtggcgcgcaggtcacctatgcagagtgctatcaacgttgccaaaaacac
tatgacggcgccatcgaaggccgtcgctggcgcgatcgtaatattcacacgctggtcgtg
accagcggtgagatgctgcatcagctgtattcgctgttccccgaggtcgatcgtgaggaa
tggctgctccgctgtcgactagtcgtcgtcagcgaacgtttggcttccctggccgccgat
cttggttggcagactattcaggtagccgatggtgccgataacgatgcgctgttgcgcacg
ttatgttga

DBGET integrated database retrieval system