KEGG   Pantoea ananatis PA13: PAGR_g4144Help
Entry
PAGR_g4144        CDS       T01970                                 

Definition
minor endoglucanase Y CelY
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
paq  Pantoea ananatis PA13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAGR_g4144
Enzymes [BR:paq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PAGR_g4144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4533100..4534104)
Genome map
AA seq 334 aa AA seqDB search
MRVKPVWSGILVLFMMFFSTQAMASGWDTYKSRFLQSDGRIIDTANNNVSHTEGQGYGML
LAVAYNDRATFDKLWKWTRTNLRNPQNDLFYWRYIPDAQDPVADKNNASDGDVLIAWALQ
RAAQKWNASDYQQESDRIQRAIVKLDVTNFGGYTVMMPGAQGFNKNSYVVLNPSYFLFVA
WQEFGQRSHLQVWNKLIDGGMALLGKMHFGNSDLPLDWVALNADGSVAPAVGYSNRFSYD
AIRVPLNIWWYDPQSLALGPFQRLWQGYGRMNTPAWFDVLANTAAPYHLEGGLLAVRDLV
LNETGYLSDKLSPEQNYFSASLQLLTWMAYQEKR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaagccagtgtggtccggtattctggtcttgtttatgatgtttttcagcacc
caggcgatggcaagtggttgggatacctataaaagccgctttcttcagtcagacggacgc
attattgatacggcaaataataatgtcagtcacactgaaggccagggttacggcatgttg
ctggcggttgcttataacgatcgcgcgaccttcgataaactctggaagtggacgcgcacg
aacctgcgcaatccgcaaaacgatctgttctactggcgctacattcctgatgcacaggat
cctgtcgcggataaaaataacgcgtccgatggcgatgtgctgattgcatgggcgttgcaa
cgggcagcgcaaaaatggaatgcaagcgattatcagcaggaatcggatcgcattcagcga
gcgatagtcaaactcgatgtgacgaacttcggtggctacaccgtaatgatgccgggcgcg
cagggattcaataagaacagctatgtggttttgaatccctcttatttcctgtttgtcgcc
tggcaggagttcggccagcgcagccatttgcaggtctggaacaagctgattgatggcggg
atggcgctgctgggtaagatgcattttggcaacagcgatctgccgcttgactgggtcgcg
ctgaacgccgacggctccgtcgcgcccgcggtgggttattcaaatcgctttagttacgat
gccatccgcgtgccgctgaatatctggtggtacgatccgcaaagcctggcgctggggcct
ttccagcgactctggcagggctatggtcgtatgaatacgccggcctggtttgatgtgctg
gccaatacggcggcgccttaccatctggaaggcggcttgctggcggtacgtgatttggtg
ctcaacgaaacaggctacctgagtgataaactgtctcctgagcagaactacttttctgcc
agcctgcagttactgacctggatggcttatcaggaaaagcgttga

DBGET integrated database retrieval system