KEGG   Pantoea ananatis PA13: PAGR_g4144Help
Entry
PAGR_g4144        CDS       T01970                                 

Definition
(GenBank) minor endoglucanase Y CelY
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
paq  Pantoea ananatis PA13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4533100..4534104)
Genome map
AA seq 334 aa AA seqDB search
MRVKPVWSGILVLFMMFFSTQAMASGWDTYKSRFLQSDGRIIDTANNNVSHTEGQGYGML
LAVAYNDRATFDKLWKWTRTNLRNPQNDLFYWRYIPDAQDPVADKNNASDGDVLIAWALQ
RAAQKWNASDYQQESDRIQRAIVKLDVTNFGGYTVMMPGAQGFNKNSYVVLNPSYFLFVA
WQEFGQRSHLQVWNKLIDGGMALLGKMHFGNSDLPLDWVALNADGSVAPAVGYSNRFSYD
AIRVPLNIWWYDPQSLALGPFQRLWQGYGRMNTPAWFDVLANTAAPYHLEGGLLAVRDLV
LNETGYLSDKLSPEQNYFSASLQLLTWMAYQEKR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaagccagtgtggtccggtattctggtcttgtttatgatgtttttcagcacc
caggcgatggcaagtggttgggatacctataaaagccgctttcttcagtcagacggacgc
attattgatacggcaaataataatgtcagtcacactgaaggccagggttacggcatgttg
ctggcggttgcttataacgatcgcgcgaccttcgataaactctggaagtggacgcgcacg
aacctgcgcaatccgcaaaacgatctgttctactggcgctacattcctgatgcacaggat
cctgtcgcggataaaaataacgcgtccgatggcgatgtgctgattgcatgggcgttgcaa
cgggcagcgcaaaaatggaatgcaagcgattatcagcaggaatcggatcgcattcagcga
gcgatagtcaaactcgatgtgacgaacttcggtggctacaccgtaatgatgccgggcgcg
cagggattcaataagaacagctatgtggttttgaatccctcttatttcctgtttgtcgcc
tggcaggagttcggccagcgcagccatttgcaggtctggaacaagctgattgatggcggg
atggcgctgctgggtaagatgcattttggcaacagcgatctgccgcttgactgggtcgcg
ctgaacgccgacggctccgtcgcgcccgcggtgggttattcaaatcgctttagttacgat
gccatccgcgtgccgctgaatatctggtggtacgatccgcaaagcctggcgctggggcct
ttccagcgactctggcagggctatggtcgtatgaatacgccggcctggtttgatgtgctg
gccaatacggcggcgccttaccatctggaaggcggcttgctggcggtacgtgatttggtg
ctcaacgaaacaggctacctgagtgataaactgtctcctgagcagaactacttttctgcc
agcctgcagttactgacctggatggcttatcaggaaaagcgttga

DBGET integrated database retrieval system