KEGG   Pantoea ananatis PA13: PAGR_p034Help
Entry
PAGR_p034         CDS       T01970                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_p034
Enzymes [BR:paq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PAGR_p034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
PAGR_p:complement(40283..41713)
Genome map
AA seq 476 aa AA seqDB search
MSEATFPEGFLWGGALSANQSEGAFLEGGKGLTTVDMIPIGPTRMPVKLGQEKRVELRDD
EFYPSHTAIDFYHRYREDIALMAEMGFTVFRTSIAWSRIFPRGDESTPNEQGLAFYRDLF
TECRKHGIEPLVTICHFDVPMHLVTQYGSWRNRKMIEFFARYARTCFDAFDGLVKYWLTF
NEINIMLHSPFSGAGLVFEPGENSEQVKYQAAHHELVASALVTKIAHEINPDNQVGCMLA
GGNFYPWSSKPDDVWAALQKDRENLFFIDIQARGAYPAYAARLFREKGIQIEMADGDADI
LKHTVDFVSFSYYASRCASAEMNDNNSSAANVVKSLTNPHIQRSEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGARDELTEKGEIIDDYRISYLREHIRAMADAIGDGIPVIGYTT
WGCIDLIAASTGEMSKRYGFVYVDRDDRGEGTLARRRKKSFWWYKKVIASNGRDLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaacattccctgaaggctttttatggggcggtgccttatccgccaatcag
tcagaaggcgcttttcttgaaggcggtaaaggactcactaccgttgacatgatccccatt
ggccccacgcgtatgccagtgaagctggggcaggaaaaacgcgttgagttgcgcgatgac
gaattctatcccagccatactgcgatcgatttttatcatcgttatcgggaagatattgcc
ttgatggcagaaatgggctttaccgtctttcgcacctcaattgcgtggagccgtatcttt
ccgcgtggcgatgaaagcacgccgaatgaacagggcctggctttttatcgtgatttgttc
accgagtgtcgtaaacatggcattgaacctttagtgacgatctgccattttgacgttccc
atgcatttggttacgcaatacggttcgtggcgaaatcgtaaaatgattgagttttttgcc
cgctatgcccgcacctgttttgacgcatttgatggtttagttaagtactggctgaccttt
aacgaaattaacatcatgctgcacagcccattttcgggtgccggattggtgtttgaacct
ggtgaaaacagtgagcaggttaaatatcaggcagctcaccacgaactggtcgcgagcgcc
ctggtgacaaaaatcgcgcatgaaatcaaccctgataatcaggtgggatgcatgctggct
ggtggcaatttttatccctggtcgagcaaacctgacgatgtctgggcggcgctacaaaaa
gatcgtgaaaacctgtttttcattgatattcaggcgcgaggtgcttatcccgcctacgct
gcgcgccttttccgcgaaaaagggattcagattgaaatggcagacggtgatgcggatata
ctcaagcataccgtcgatttcgtgtcgttcagctattatgcatcccgatgtgcttcggcc
gagatgaatgacaacaatagcagcgcggcaaacgtggtgaaatccctcaccaacccgcat
attcagcggagtgaatggggctggggcatcgatccgcttggcctgcgcatcaccatgaat
atgatgtatgaccgttatcagaagccgcttttcctggtcgagaatggcctgggcgcacgc
gatgagttaacggagaaaggcgaaattattgacgattatcgtatcagctacctgcgcgaa
catatccgggcgatggccgatgcgatcggagacggtattcctgttatcggctataccaca
tggggctgtatcgatctgattgccgcatcaaccggcgaaatgagcaaacgttacgggttc
gtttatgtggatcgtgacgatcgtggagaaggcacgctggcccggcggcggaaaaagtcc
ttctggtggtataaaaaggtgatagcaagtaacggcagggatttggattaa

DBGET integrated database retrieval system