KEGG   Pantoea ananatis PA13: PAGR_p104Help
Entry
PAGR_p104         CDS       T01970                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00010  Glycolysis / Gluconeogenesis
paq00520  Amino sugar and nucleotide sugar metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
Module
paq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_p104
   00520 Amino sugar and nucleotide sugar metabolism
    PAGR_p104
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     PAGR_p104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AER34774
Position
PAGR_p:complement(124933..125628)
Genome map
AA seq 231 aa AA seqDB search
MTRQTKKKKDHVVLSIDIGGSHVKILSSTGGVKKKADSGKNMSAADMVAAVKTLAEGMSY
HVIAMGFPGPVADNKPIREPANLGEGWVGFDYAGAFGCPVRIVNDALMQALGSYQGGRML
FLGLGTGLGAAMIIENVAQPMEIAHLPYRKGNSYEHYVGEAYRVKKGNKKWQARVFDVVE
MLTTALQPDYVVLGGGNVDELDSLPPKCRKGDNTLAFEGGFRLWNDPSLIT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggcaaactaaaaaaaagaaagatcatgttgttttgtccatcgacatcggcgga
agccatgtgaagatcctctccagcactggcggggtaaaaaagaaggcagatagtggaaaa
aacatgtcggccgcagacatggttgccgcggttaagaccctggctgaaggcatgtcctat
catgtgatcgcgatgggatttccgggtcccgtcgcggacaataaacccattcgggagccc
gccaacctcggtgagggctgggtggggtttgactatgcaggcgcatttggctgccctgtt
cgtatcgtcaacgacgccctgatgcaggcgctgggttcctatcagggcggacgcatgctg
ttcctcggtcttggcacgggactaggggctgcgatgatcatcgaaaacgtcgctcagccc
atggagatcgctcacttaccttatcgcaaaggcaatagctacgaacactacgtaggtgaa
gcctaccgggtaaaaaaggggaacaaaaaatggcaggcgcgggtttttgacgtggtggaa
atgctgaccaccgcgttgcagcctgactacgtggttttaggcggaggaaacgtagatgaa
cttgactcactcccgccaaagtgccggaaaggcgacaacacactggcattcgagggggga
tttcgtctctggaacgatccgagcttaattacttga

DBGET integrated database retrieval system