KEGG   Pantoea ananatis PA13: PAGR_p107Help
Entry
PAGR_p107         CDS       T01970                                 

Definition
glucoamylase Cga
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
paq  Pantoea ananatis PA13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
PAGR_p:complement(128041..130542)
Genome map
AA seq 833 aa AA seqDB search
MSNADSDAVPLQTCMKHDDPPLRAGVDAAPGRPGIEARWTSSAKSGIGTALSSDSRVWFT
LSHGVLNEIYYPRVDSACTRDCVFVITGPEGYFSEEKRDCLTETRPHSPGIPAFTITNTA
RDGLYRLEKDIITDPARDCVLQRVRFTALKGNVEHYTVTALLAPHLVNAGQMNAAWIGEF
DDKPVLFATGRSRYLALVCDIPWTAMSAGFVGMSDGWQQLKEQGRLVNQYRRADDGNVAL
AGELAFTSACSEATLAIGFGQTESEAAAAATASLNAGFDKARDGYIRNWQAWQDRLIPLD
QEARNGVNTYRVSTAVLASHRAADCPGAVVASLTIPWGFSKGDDDLGGYHLVWPRDLVET
AGGFLAAGDADQALAILEYLRRVQEPSGRWPQNLWLDGKPYWPGIQMDECAFPLLLMDML
RRLGYLDNKAQKRFMPMLRRAACYILTNGPATAEDRWEEDSGYSPFTLAVEIAALLAAAD
LLSIDGDEAAANHLRETADCWNEQIEKWTFAGDPHFCTSIGISGHYVRIAPSGATDEVSA
SGNTEIRNQTPDRALLPTADVLSPDALALVRFGLRAADDPHILDTIKAIDHSLRVDLPQG
PLWYRYTGDGYGEHADGAPFDGIGQGRPWPLLAGERAHYELAAGRHDAAEALLATLEKSA
GSGGLLPEQVWDGPDIPDKALFFGRPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGV
ERYIRNKTGSHLRIWRFNNRVSSLPVGKQLRLETEANALVHWSTDDWATVSDSPARSSGL
GTYYVDLPVQHETAGTRVVFTFYWPDVEHWENTDFTVHVVNEPNDQTRIGNGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgctgacagcgacgccgtcccgttgcaaacgtgcatgaagcatgacgacccg
ccattacgcgcaggcgttgacgccgccccgggaaggccaggaattgaagcccgatggaca
tcgagtgccaagagcggaatcggcacggccctttcatcagactcgcgcgtctggttcacc
ttgagccacggcgttctcaacgaaatctattatccacgcgttgacagcgcctgtacccgc
gattgcgtcttcgttatcacggggcctgaaggttatttctccgaagaaaagcgcgactgc
ctgaccgaaacccgaccccactcgccaggcattccggccttcaccatcaccaacacggcg
cgtgacggcctctacaggcttgagaaggacatcattactgatccggcccgtgactgtgtg
ctgcagcgggtccgtttcaccgcgttgaaggggaacgttgagcattacaccgtcaccgca
ctgctcgctccccatctggtgaatgccggacaaatgaacgccgcctggatcggcgaattt
gacgataagccagtgcttttcgccaccggccgctcccgctatctggcgctcgtctgcgac
atcccctggacggcaatgagcgccgggtttgtcggtatgtcagacggctggcagcagctt
aaagaacagggacgccttgtgaaccaataccggcgggcagacgatggcaatgtcgcgctt
gccggagagctggcgttcaccagcgcctgcagtgaagccacgctggctattggtttcggc
caaacggaatccgaggccgcagcggcggcaaccgccagtcttaacgcgggctttgataaa
gcgcgcgatgggtatattcgcaactggcaagcgtggcaggacaggctcattccactcgat
caagaagcgcgaaacggcgtcaatacataccgggtttcaacggcggtactggcctcgcac
agagccgctgattgtcccggcgccgttgtcgcgagcctgacgataccctggggattttcg
aagggcgatgacgatcttggcggctatcatctggtctggccgcgagacctggtcgaaacg
gcagggggtttcctggccgcaggcgacgccgaccaggcactcgccattctggaatatctc
cgtcgtgttcaggagccctccgggcgctggccacagaacctgtggctggatggaaaaccc
tactggccaggcatccagatggatgagtgtgcattcccccttctgcttatggatatgctg
cgcagactcggctatctcgacaataaagcgcagaaacgctttatgcctatgctacgccgc
gcggcctgctacattttgaccaacggcccggcgaccgcggaggaccgctgggaggaagac
tcaggctacagtccgtttaccctggcggtcgagatcgctgcactgcttgccgccgcggat
ctgctttcgatagacggagatgaagcggcggcaaaccacctgcgagaaaccgcagactgc
tggaatgagcagattgaaaaatggacctttgccggggatccccatttttgcacctcgatt
ggcatttccggtcactatgtccgcatcgcgccgtcgggcgcaacggatgaggtcagcgca
tccggcaataccgagattcgcaaccagacaccggatcgggcgcttctgccgaccgctgat
gtgctgagcccggatgccctggcactggtgcgtttcggcctgcgtgcagcggacgacccg
cacatccttgatacgataaaggctattgaccacagtcttcgggtcgatttacctcagggg
ccattgtggtatcggtacaccggtgatggctatggcgaacacgcagacggcgcgccgttc
gacggtatcggccaggggcgtccatggcctctgctggcgggcgaacgcgcgcattacgag
ctggcagcgggcaggcacgacgcggctgaggcgctcctggccacgctggaaaaatcggca
ggctcgggcgggctgttaccggaacaggtatgggacggccccgatattcccgataaggcg
ctgttcttcgggcgtccttccggtagcgccatgccgcttgtctgggcacattccgaacat
attaaactgctgcgatcgcttcgcgatggcgcggtcttcgatatgccaccccaaggcgtt
gaacgctatatcagaaataagaccggatcgcatttgcgcatatggcgctttaacaaccgc
gtatcctcccttcctgtcgggaagcaactgaggctggaaacggaagcgaacgccctggtg
cactggagtacggatgactgggctaccgtttctgactccccggcgcgctcttcggggctt
ggaacctattatgtggacctgcctgtacagcacgaaaccgcaggaacccgtgttgtcttt
accttttactggcctgacgttgaacattgggaaaacaccgattttaccgttcacgtcgta
aatgaaccgaacgatcaaacccgcattggcaatggagaatga

DBGET integrated database retrieval system