KEGG   Pantoea ananatis PA13: PAGR_p219Help
Entry
PAGR_p219         CDS       T01970                                 

Definition
(GenBank) glutaminase 1 GlsA1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00220  Arginine biosynthesis
paq00250  Alanine, aspartate and glutamate metabolism
paq00471  D-Glutamine and D-glutamate metabolism
paq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAGR_p219
   00220 Arginine biosynthesis
    PAGR_p219
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PAGR_p219
Enzymes [BR:paq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PAGR_p219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AER34881
Position
PAGR_p:250998..251918
Genome map
AA seq 306 aa AA seqDB search
MTTLSNSLLEAVLEQVRPLVHQGKVANYIPALADVAADHLGIAVCLRDGTVFQAGDAETR
FSIQSISKVLSLTVALTRYEDAEIWRRVGKEPSGQPFNSLVQLELEQGKPRNPFINAGAL
VICDLLETRLTAPRQRMLEIIRQLSQQSDIQYDRHVARSEYEHSARNAAIAWLMKSFGNF
DNDVTSVMQTYFHYCSLSMNCIELARSFIYLANQGKTLDGASLISSRQARQINALMITSG
MYDGAGEFAWRVGMPAKSGVGGGIIAVIPGEMSIAVWSPGLDSAGNSLAGTAALECLTDK
LGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactctcagtaattcactgcttgaagccgttcttgagcaggtccgtccgttagtt
catcagggcaaagtcgctaattacattccggcgctggctgacgtcgcggccgaccatctg
ggtatagcggtctgtttacgtgatggcacagtttttcaggcaggcgatgctgaaactcgt
ttttcgatccagtccatttcgaaagtgctctcactcaccgtcgcgctgacgcgttatgag
gatgcggagatatggcggcgagtgggtaaagaaccctccggtcagccttttaattcgctg
gttcagcttgaactggagcagggaaaaccccgtaatccctttattaacgccggggcgctg
gtgatctgcgatttgcttgaaacccggctgacagcaccgcgtcagcgtatgctggaaata
atccgtcagctcagtcagcaatcggatattcagtacgatcgtcacgtcgcccgttctgaa
tacgaacactctgcccgcaacgcggctatcgcctggctgatgaagtcatttggtaatttt
gacaacgacgtcaccagcgttatgcagacttattttcactactgctcattgtccatgaac
tgtattgaactggctcgcagttttatttatctggctaatcagggaaaaaccctggatggc
gcgtccctgatttcgtcccgccaggcgcggcagatcaatgcgctaatgattaccagcggt
atgtacgacggggctggcgaatttgcctggcgggtgggcatgcccgccaaatccggggtt
ggcggcggtatcattgccgtcattcctggtgaaatgagcatcgcggtctggtcacccgga
ttggatagcgcgggcaattcgttagccggcaccgccgcgctggagtgcctgactgacaaa
ctcggtcgttcgatattctga

DBGET integrated database retrieval system