KEGG   Pantoea ananatis PA13: PAGR_p219Help
Entry
PAGR_p219         CDS       T01970                                 

Definition
glutaminase 1 GlsA1
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
paq  Pantoea ananatis PA13
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAGR_p219
   00330 Arginine and proline metabolism
    PAGR_p219
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PAGR_p219
Enzymes [BR:paq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PAGR_p219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
PAGR_p:250998..251918
Genome map
AA seq 306 aa AA seqDB search
MTTLSNSLLEAVLEQVRPLVHQGKVANYIPALADVAADHLGIAVCLRDGTVFQAGDAETR
FSIQSISKVLSLTVALTRYEDAEIWRRVGKEPSGQPFNSLVQLELEQGKPRNPFINAGAL
VICDLLETRLTAPRQRMLEIIRQLSQQSDIQYDRHVARSEYEHSARNAAIAWLMKSFGNF
DNDVTSVMQTYFHYCSLSMNCIELARSFIYLANQGKTLDGASLISSRQARQINALMITSG
MYDGAGEFAWRVGMPAKSGVGGGIIAVIPGEMSIAVWSPGLDSAGNSLAGTAALECLTDK
LGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactctcagtaattcactgcttgaagccgttcttgagcaggtccgtccgttagtt
catcagggcaaagtcgctaattacattccggcgctggctgacgtcgcggccgaccatctg
ggtatagcggtctgtttacgtgatggcacagtttttcaggcaggcgatgctgaaactcgt
ttttcgatccagtccatttcgaaagtgctctcactcaccgtcgcgctgacgcgttatgag
gatgcggagatatggcggcgagtgggtaaagaaccctccggtcagccttttaattcgctg
gttcagcttgaactggagcagggaaaaccccgtaatccctttattaacgccggggcgctg
gtgatctgcgatttgcttgaaacccggctgacagcaccgcgtcagcgtatgctggaaata
atccgtcagctcagtcagcaatcggatattcagtacgatcgtcacgtcgcccgttctgaa
tacgaacactctgcccgcaacgcggctatcgcctggctgatgaagtcatttggtaatttt
gacaacgacgtcaccagcgttatgcagacttattttcactactgctcattgtccatgaac
tgtattgaactggctcgcagttttatttatctggctaatcagggaaaaaccctggatggc
gcgtccctgatttcgtcccgccaggcgcggcagatcaatgcgctaatgattaccagcggt
atgtacgacggggctggcgaatttgcctggcgggtgggcatgcccgccaaatccggggtt
ggcggcggtatcattgccgtcattcctggtgaaatgagcatcgcggtctggtcacccgga
ttggatagcgcgggcaattcgttagccggcaccgccgcgctggagtgcctgactgacaaa
ctcggtcgttcgatattctga

DBGET integrated database retrieval system