KEGG   Psychrobacter arcticus: Psyc_0011Help
Entry
Psyc_0011         CDS       T00256                                 

Definition
Zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
par  Psychrobacter arcticus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Psyc_0011
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyc_0011
  Lipid metabolism
   00071 Fatty acid degradation
    Psyc_0011
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psyc_0011
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyc_0011
   00626 Naphthalene degradation
    Psyc_0011
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psyc_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(14993..15997)
Genome map
AA seq 334 aa AA seqDB search
MSKHRTFKALVVEENTNGTFSKSIQERSVSDLPENDLLIEVHYSSLNFKDAMSASGNKRI
TKQYPHTPGIDAAGVVVSDKSGTFTAGQEVLVFGYDLGMNTDGGLSQMISIPADWALACP
ETLTLKEAMTYGTGGLTAALSVQKLEKMGAKPSDGPVAVTGATGGVGSISIAILKQLGYE
VIAFSGKPEQSEHLKDLGASEVRHRDTINEIGNKPIGRELWANAIDTIGGDYLANLLKQT
KAGGVVTSCGLAGGAEFSMTVMPFITRAVSLLGIDSVYIPLADKKAIWERVATDMKLPNL
ESYGEEITLEQTPEYLDRFMSSQVVGRYVVNVRG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcacagaacgtttaaagctttggtcgtcgaagaaaatactaacggcactttt
agcaaaagcattcaagaacgcagcgtcagtgacctacctgaaaatgatctattaatcgaa
gtgcattattcatcattaaatttcaaagacgcgatgtcggcatcgggtaataaaaggatc
accaaacaatatccacatacccccggtattgatgcagcaggcgtcgtcgtcagcgacaaa
tcaggcacgtttaccgcagggcaagaagtattggtatttggctatgatttgggcatgaat
accgatgggggcttaagtcaaatgatatctatacccgcagattgggcgctggcgtgccca
gaaacactgacactaaaagaagcgatgacttatggtactggtggcttgaccgcagcacta
agtgtccaaaagctagaaaaaatgggtgcaaaaccaagcgatggtccagtagccgtcact
ggtgcaacgggcggtgtgggcagcatcagtatcgccatcttaaaacaactcggctatgag
gtcattgcgttctcagggaagcctgagcaaagcgagcacctaaaagacttaggagcaagc
gaagtgcgtcatcgcgatactatcaatgaaatcggcaataaacctattggccgtgaatta
tgggccaatgccattgatacgatcggcggtgattatttggcaaacttgcttaaacagacc
aaagctggcggggtggttactagttgtggcctagcgggcggcgctgaattttcgatgacg
gtcatgccgtttatcactagagcggtgtcgttgttgggtatcgactcggtatatattccg
ctggcggataaaaaggctatctgggagcgcgtcgccaccgatatgaaactgcccaatctt
gagagctatggcgaagaaatcaccttagagcaaacgccagaatacttagaccgctttatg
tcgagtcaagtcgtgggtcgttatgtggtgaatgtgcggggttag

DBGET integrated database retrieval system