KEGG   Psychrobacter arcticus: Psyc_0011Help
Entry
Psyc_0011         CDS       T00256                                 

Definition
(GenBank) probable Zinc-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
par  Psychrobacter arcticus
Pathway
par00010  Glycolysis / Gluconeogenesis
par00071  Fatty acid degradation
par00350  Tyrosine metabolism
par00625  Chloroalkane and chloroalkene degradation
par00626  Naphthalene degradation
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01130  Biosynthesis of antibiotics
par01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyc_0011
  Lipid metabolism
   00071 Fatty acid degradation
    Psyc_0011
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psyc_0011
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyc_0011
   00626 Naphthalene degradation
    Psyc_0011
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psyc_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Epimerase AlaDh_PNT_C NAD_binding_10 NmrA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAZ17885
UniProt: Q4FVS3
Position
complement(14993..15997)
Genome map
AA seq 334 aa AA seqDB search
MSKHRTFKALVVEENTNGTFSKSIQERSVSDLPENDLLIEVHYSSLNFKDAMSASGNKRI
TKQYPHTPGIDAAGVVVSDKSGTFTAGQEVLVFGYDLGMNTDGGLSQMISIPADWALACP
ETLTLKEAMTYGTGGLTAALSVQKLEKMGAKPSDGPVAVTGATGGVGSISIAILKQLGYE
VIAFSGKPEQSEHLKDLGASEVRHRDTINEIGNKPIGRELWANAIDTIGGDYLANLLKQT
KAGGVVTSCGLAGGAEFSMTVMPFITRAVSLLGIDSVYIPLADKKAIWERVATDMKLPNL
ESYGEEITLEQTPEYLDRFMSSQVVGRYVVNVRG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcacagaacgtttaaagctttggtcgtcgaagaaaatactaacggcactttt
agcaaaagcattcaagaacgcagcgtcagtgacctacctgaaaatgatctattaatcgaa
gtgcattattcatcattaaatttcaaagacgcgatgtcggcatcgggtaataaaaggatc
accaaacaatatccacatacccccggtattgatgcagcaggcgtcgtcgtcagcgacaaa
tcaggcacgtttaccgcagggcaagaagtattggtatttggctatgatttgggcatgaat
accgatgggggcttaagtcaaatgatatctatacccgcagattgggcgctggcgtgccca
gaaacactgacactaaaagaagcgatgacttatggtactggtggcttgaccgcagcacta
agtgtccaaaagctagaaaaaatgggtgcaaaaccaagcgatggtccagtagccgtcact
ggtgcaacgggcggtgtgggcagcatcagtatcgccatcttaaaacaactcggctatgag
gtcattgcgttctcagggaagcctgagcaaagcgagcacctaaaagacttaggagcaagc
gaagtgcgtcatcgcgatactatcaatgaaatcggcaataaacctattggccgtgaatta
tgggccaatgccattgatacgatcggcggtgattatttggcaaacttgcttaaacagacc
aaagctggcggggtggttactagttgtggcctagcgggcggcgctgaattttcgatgacg
gtcatgccgtttatcactagagcggtgtcgttgttgggtatcgactcggtatatattccg
ctggcggataaaaaggctatctgggagcgcgtcgccaccgatatgaaactgcccaatctt
gagagctatggcgaagaaatcaccttagagcaaacgccagaatacttagaccgctttatg
tcgagtcaagtcgtgggtcgttatgtggtgaatgtgcggggttag

DBGET integrated database retrieval system