KEGG   Psychrobacter arcticus: Psyc_0065Help
Entry
Psyc_0065         CDS       T00256                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
par  Psychrobacter arcticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyc_0065 (tpiA)
   01230 Biosynthesis of amino acids
    Psyc_0065 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyc_0065 (tpiA)
   00051 Fructose and mannose metabolism
    Psyc_0065 (tpiA)
   00562 Inositol phosphate metabolism
    Psyc_0065 (tpiA)
Enzymes [BR:par01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Psyc_0065 (tpiA)
Exosome [BR:par04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Psyc_0065 (tpiA)
  Exosomal proteins of bladder cancer cells
   Psyc_0065 (tpiA)
  Exosomal proteins of melanoma cells
   Psyc_0065 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73127..73936
Genome map
AA seq 269 aa AA seqDB search
MQAWVIGNWKQNPATSHDVDALLNELCTAISTTKQLSHNNSTRCQIMVAPSFLHLAAVSS
RLKDTSVLCAAQDVSAYSASVGAYTGDCSAQQIADVGATWTILGHSERRQYHQESNDTLL
QKMTHALTQELGVVFCIGETQAQYDAKQTLPVIDSQLAVVKKLIAEQPEVIDSLSTRLII
AYEPVWAIGTGKVPTVSEVSATHQYIKQTLAGFADSLSNMTVLYGGSVNADNADSFAADP
MIHGALVGGASLKAESFLAIVTAFSKGSM
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttgggtaattggaaattggaagcagaatccagcaacgagccatgacgttgac
gcgctactgaatgaattatgcactgctattagtacaactaagcaacttagccacaacaac
tccacgcgctgtcaaataatggtggcaccaagttttttgcatttagcagcagtgagtagt
cgcctcaaagacacctcggtactatgtgccgcccaagacgtcagtgcctatagtgccagt
gtgggcgcctataccggtgactgttcagcccagcagattgctgatgttggggctacatgg
accatccttggtcactcagagcgccgtcagtaccaccaagaatccaacgatactttattg
caaaaaatgacccatgctttgacccaagagttgggcgtagtattttgtatcggtgaaacc
caagcacaatatgatgccaagcaaacgctgccagtcatcgatagtcagttagcagtggtc
aaaaagctcattgctgagcagccagaagttattgattcattatcgactcgtctcattatt
gcttacgagccggtatgggcgattggtactggtaaagtaccaacagtgtcagaggtgagt
gccactcatcaatatatcaagcaaacactggcaggttttgccgattcgttatctaacatg
actgttttgtatggcggtagtgtcaatgctgataatgcagatagctttgctgctgatcct
atgattcatggtgctttggttggcggcgcttcactaaaggcagagagctttttggcgatt
gtcaccgcttttagtaaaggcagtatgtaa

DBGET integrated database retrieval system