KEGG   Psychrobacter arcticus: Psyc_0099Help
Entry
Psyc_0099         CDS       T00256                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
par  Psychrobacter arcticus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyc_0099 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psyc_0099 (sdhD)
   00650 Butanoate metabolism
    Psyc_0099 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Psyc_0099 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114609..115013
Genome map
AA seq 134 aa AA seqDB search
MKNDSGIKSATSLTGSGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVTYTEWSNFMTSL
PMRLFSLVAVLALAGHAWIGMWTVFTDYITTGKLGASAAGLRLVLQTLMIIAVLVFLFWG
IMIFWGNGFGVVAV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgattcaggaatcaaaagcgcaaccagtctaaccggctcaggttcacgtgat
tggattgtccagcgtatcagtgcggtggtcttggcagtttacagtgtggtgctactgggc
ttctttttgacccatggcgatgtcacttatactgaatggtcaaactttatgactagccta
ccaatgcgtctgtttagcttagtggcagttctagcccttgccggtcacgcatggattggc
atgtggaccgtatttactgactatatcactacaggcaaactgggcgcgagcgcagcgggt
ctacgtctggtattacagaccttaatgattattgccgttttagtatttttattctggggc
atcatgattttttggggtaatggcttcggtgtcgttgctgtttaa

DBGET integrated database retrieval system