KEGG   Psychrobacter arcticus: Psyc_0103Help
Entry
Psyc_0103         CDS       T00256                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
par  Psychrobacter arcticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyc_0103 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psyc_0103 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Psyc_0103 (sucB)
Enzymes [BR:par01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Psyc_0103 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
122097..123329
Genome map
AA seq 410 aa AA seqDB search
MAEIKAPVFPESVADGTIVEWHVTEGQQVNRDDLLAEIETDKVVLEVVAPDNGVVTRIVK
QVDDTVLSDELIAEFEAGASASAEAAPAVDPDQPAAPVQPKQATDGGEPAQASAEADHKD
QSPAVRKAAKVSGVDPKNVEGSGRGGRVTKTDMSNPTLKADSSITSDSGRPVAEAVGERT
EKRVPMTRLRKTIANRLLAASQETAMLTTFNEVNMKPLMDMRTKYKDQFEKRHGTRLGFM
SLFVKAATEALKRYPAVNASLDGDDIVYHGYYDIGVAVSSNRGLVVPVLRDTDRMSMADV
EAKIREFGGKAQEGKLGLEDMVGGTFTISNGGVFGSLMSTPILNPPQTAILGMHAINDRP
MAVNGEVKILPMMYLALSYDHRMIDGKEAVQFLVTLKELVEDPTMLLLDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattaaagcccccgtttttccagaatcggttgccgatggtacaatcgttgaa
tggcatgtcactgaaggtcagcaagtaaaccgtgatgacctattagctgaaatcgaaact
gacaaagttgtattggaagtggtcgcgcctgataacggtgttgtgaccagaatcgttaag
caagtagacgataccgtgttgtctgatgagctgattgctgaatttgaagctggtgctagc
gccagtgctgaagcggctcctgctgttgatccagatcaaccagctgcgccagtacaacct
aagcaagcaacagatggcggcgagccagcacaagcgtctgctgaagctgatcataaagat
caaagcccagcggtacgtaaagcggctaaagtctctggtgtagatcctaaaaacgttgaa
ggcagtggtcgcggcggtcgtgtgaccaaaactgatatgtcaaacccaacgttaaaagcg
gacagctcaatcacttctgatagtggtcgtcctgttgctgaggcagttggcgagcgtaca
gagaaacgcgtgccaatgacacgtctacgtaagacaatcgcgaatcgtctgctagccgct
tctcaagaaacggcaatgctaacgacgttcaacgaagtcaacatgaaaccgttgatggac
atgcgtactaagtataaagatcagtttgaaaagcgtcatggcacacgtttaggctttatg
tcgttattcgtaaaagcggcgactgaagcactaaaacgctacccagctgtcaacgcgtca
ttagacggtgatgatattgtttatcatggttactatgacatcggtgttgccgtatcttct
aaccgtggtcttgtagtaccagtattgcgtgatactgatcgtatgagcatggcagatgtt
gaagccaagattcgtgagtttggtggtaaagcacaagaaggaaagcttggtctagaagac
atggttggcggtacgtttaccatctcaaacggtggtgtatttggttcattgatgtcaaca
cctatcttgaacccaccacaaaccgctatcttgggtatgcatgcgatcaatgaccgtcct
atggcggttaatggcgaagttaaaatcttgccaatgatgtatcttgcattgtcttatgac
catcgtatgattgatggtaaagaagcggtacaattcttagtaacattgaaagaattggtt
gaagaccctactatgctactcttagatctttaa

DBGET integrated database retrieval system