KEGG   Psychrobacter arcticus: Psyc_0108Help
Entry
Psyc_0108         CDS       T00256                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
par  Psychrobacter arcticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Psyc_0108 (galU)
   00052 Galactose metabolism
    Psyc_0108 (galU)
   00500 Starch and sucrose metabolism
    Psyc_0108 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Psyc_0108 (galU)
Enzymes [BR:par01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Psyc_0108 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128569..129453
Genome map
AA seq 294 aa AA seqDB search
MKKITHAVIPVAGFGTRMLPLSKSVPKELLPLGNRPAIHYVVEEAIAAGIKHIVLVGHAQ
KSAIENYFDINAELDNQLRDKGKDELADSLNWLPDDVTISMIRQGQPLGLGHAVLAARPI
IGQHDFAVLLPDVVLDPFNGDMSADNLAFMMDAFAKDNHSQILVDKVADEDVHKYGIAQL
NEALSGVSSVDNEIDANISFKVAGFVEKPNVVDAPSRLAVVGRYVFSHHIFDYLANTKAS
VGGEIQLTDAIDALISEYGVNVTTMRGNSYDAGDMRSYMQAFMYFAQQQLADEE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattactcacgcggtgatacccgttgcaggctttggcactcgtatgttgcca
ttgtctaagtcagtacctaaagaactattgccgcttggtaatcgccctgccattcattat
gtagttgaagaagctattgctgccggcattaaacatatcgtcttagtcggtcatgcgcaa
aaaagcgcgattgaaaactactttgacatcaatgccgagctggataatcaattgcgtgat
aagggcaaagatgagctagcagacagcttaaattggctaccagatgatgtgaccatatca
atgatacgtcagggtcagccattaggtttggggcatgcggtgcttgctgcacgtccgatt
attggtcagcatgattttgcggtactcttaccagatgtggtacttgatccctttaacggt
gatatgtctgctgataatttagcttttatgatggacgcttttgctaaagataaccattca
cagatattggtagacaaggttgctgatgaagacgtacataaatatggtattgctcaacta
aatgaagcgttgagtggtgtaagtagtgtagataatgaaatagatgcaaatattagcttt
aaagtggcaggttttgtagaaaaaccaaatgtagttgatgcaccctcaagactcgccgtg
gttggtcgctatgtctttagccaccatatttttgactatctggcgaataccaaagcttca
gttggcggagagattcagttgacagatgctattgatgcacttatcagtgaatatggtgtc
aatgtcacgaccatgcgcggtaacagttatgatgccggcgatatgcgctcttacatgcaa
gcctttatgtattttgctcagcagcaattagccgatgaagagtag

DBGET integrated database retrieval system