KEGG   Psychrobacter arcticus: Psyc_0115Help
Entry
Psyc_0115         CDS       T00256                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
par  Psychrobacter arcticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psyc_0115 (folK)
Enzymes [BR:par01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Psyc_0115 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138151..138732
Genome map
AA seq 193 aa AA seqDB search
MNMSLTDIHKNSDNSADMNARPWVTCYVGLGSNLANELGAPVEHLQHAFEMLQEAEKIRT
VRISSFYASVPMGPQDQPDFVNAVAGFETILKPFELLTFCQQLEQQAKRARLRHWGERSL
DVDILLYGDEQVAEPQLTIPHAGLHERNFVLIPLRELVPELIIAGKSIVDYPQSSDWAGL
KLLSNAELSRNQI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagccttactgacattcataaaaattctgataatagtgcggatatgaatgcg
cgcccttgggttacttgctatgttggtttgggtagtaatctggcaaatgagcttggggcg
cctgttgagcatttacagcacgcgtttgagatgctgcaagaggcagaaaaaatacgcaca
gtgcgtatttcttcgttttatgcatcagtgccgatgggaccgcaagatcagccagatttt
gtgaacgccgttgctggctttgaaactatcttaaagccgtttgagctgcttactttttgt
cagcagttagagcagcaagcaaaacgcgcccgccttcgtcattggggtgagcgcagcctt
gatgtggatatattgttatacggtgatgaacaagttgccgagccgcagttaacgataccg
catgcgggattgcacgagcgtaattttgtcttgataccgttacgagaactagtaccagag
ttaatcattgctggaaaatcgatagtcgattatccacaaagcagcgattgggcaggctta
aagttattatcaaatgctgagctaagccgtaatcaaatatag

DBGET integrated database retrieval system