KEGG   Psychrobacter arcticus: Psyc_0184Help
Entry
Psyc_0184         CDS       T00256                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
par  Psychrobacter arcticus
Pathway
par00010  Glycolysis / Gluconeogenesis
par00620  Pyruvate metabolism
par00640  Propanoate metabolism
par00680  Methane metabolism
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01130  Biosynthesis of antibiotics
par01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyc_0184 (acs)
   00620 Pyruvate metabolism
    Psyc_0184 (acs)
   00640 Propanoate metabolism
    Psyc_0184 (acs)
  Energy metabolism
   00680 Methane metabolism
    Psyc_0184 (acs)
Enzymes [BR:par01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psyc_0184 (acs)
Lipid biosynthesis proteins [BR:par01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psyc_0184 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAZ18057
UniProt: Q4FVA1
Position
216448..218409
Genome map
AA seq 653 aa AA seqDB search
MTQKSFPITPEFLAAANVTAEQYVEQYQQSIASPEATDAFWAKQAELIDWIKKPTKISDV
SYDLEDFRIKWFEDGELNISVNCLDRHVKNNPYKPAIIWEGDHPSLHKIISFKELHEAVC
RLGNAMRKLGVKKGDRVTLYMPMIPEAVVAMLACTRIGAVHSVVFGGFSTQSLGNRIIDS
QSKLVITADEGIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTGNSVPMSGRRDIWYH
SLVDGESQYCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRDVFDVKDD
DVYWCTADVGWVTGHTYATYAPLANGTTTVMFEGVPEYPTWARIGHIIDKHQITVLYTAP
TAIRAMMKEGDTFVRESDRSSLRLLGTVGEPINPEAWDWYYHIVGGGKCPVVDTWWQTET
GGIMLAPIPGTVAMKPGAVMNPLYGIIPEVIDTDGVALEGAAEGNLVINGSWPGQMRTIY
KDHARFLETYFTEYPGYYFTGDGVQRDEDGHYWITGRVDDVLNVSGHRLGTAEIESAIVA
HPATAEAAVVGMPHDIRGIGICAFVILKSSETATESLKAELNRHVRTEIGPIANLDAIYM
VNVLPKTRSGKIMRRILRSLAAGQYVGLGDLSTLADSSVINELVEVVKTERAK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaaatcatttccaattacgcctgaattcctcgccgctgccaatgttactgcc
gagcagtatgttgaacaataccaacaatccattgcgtcacctgaagcgacagatgccttt
tgggcgaagcaggccgagctgattgattggataaaaaagcccaccaaaatcagtgatgtc
agctacgacttagaggattttcgcattaagtggttcgaagatggcgagctgaatatttca
gtcaactgtcttgatcgtcatgtcaaaaacaacccctacaagcctgccatcatttgggaa
ggggatcatccctccctacataaaataatctcatttaaagagctgcatgaagcagtttgt
cgcttaggtaatgccatgcgcaagcttggggttaaaaagggcgaccgcgtcaccttatat
atgccgatgatacctgaagcagtggtcgcaatgctggcgtgtacgcgtattggagcagta
cactcggtggtgtttggcggcttttctacgcaaagcttgggtaaccgtattattgatagc
cagtccaagctggtcatcaccgctgatgaaggtatccgtggtaacaagcgtacgccactc
aaagccaatgtcgatcgtgctctagatatggatggcacagacagcgttagcaatgtcatc
gtcgtccatcgtaccggcaattcagtgccgatgagtggtcgccgtgatatctggtatcac
agcttggtcgatggtgaatcgcagtactgtgaacctgaagtgatgaatgcagaagacccg
ctgtttttattatatacctctggttcaacaggtaagcccaaaggcgtgttgcacaccaca
ggcggctatatcacttatgcgctgtccacgtttcgtgatgtttttgatgttaaggatgat
gatgtgtactggtgtactgcggacgtcggttgggtgacgggtcatacctacgccacttac
gcaccgcttgccaatggcacgacgacagtcatgtttgagggcgtgccagagtatccgaca
tgggcacgcattgggcatatcattgataagcatcaaataaccgttttatataccgcaccg
accgctattcgcgccatgatgaaagagggcgatacctttgtacgtgagtcggaccgctca
agtctgcgcttactcggcacggttggtgaacctatcaatcctgaagcgtgggactggtac
tatcatatcgtcggtggcggtaagtgtccggtcgtcgatacctggtggcagaccgaaacc
ggcggtattatgctagcaccaataccggggacggttgcgatgaagccaggcgcggtgatg
aatccgctatatggcatcataccagaggtcattgataccgatggcgttgcgcttgaaggt
gctgctgaaggtaatttggtaattaatggtagctggcctggtcaaatgcgcaccatttat
aaagaccacgcgcggtttttagagacttattttaccgaatatcccggctattatttcacg
ggcgatggggtacagcgtgatgaagatggtcactactggattaccggtcgtgttgacgac
gtgcttaatgtgtcagggcatagactgggcacagcagagattgaaagtgcgatagtcgcc
cacccagcgacggcagaggcggcagtggtaggaatgccacacgatatacgcggtataggt
atttgtgcttttgttatcttaaagtcgagtgaaacggcaactgagtcactaaaagcagaa
ttaaaccgccatgtacgcaccgagattggtccgattgccaatttagatgccatctatatg
gtcaatgtgttacccaaaacgcgctctggtaaaatcatgcgccgcatattgcgtagtcta
gcggcagggcagtatgttggtcttggtgatttatctaccctagctgatagctcagttatc
aatgagctggtcgaagtggtcaagacagaacgtgcaaaatag

DBGET integrated database retrieval system