KEGG   Psychrobacter arcticus: Psyc_0254Help
Entry
Psyc_0254         CDS       T00256                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
par  Psychrobacter arcticus
Brite
Enzymes [BR:par01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Psyc_0254 (dsbC)
Secretion system [BR:par02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Psyc_0254 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(304875..305732)
Genome map
AA seq 285 aa AA seqDB search
MFLAPFSKTMLNRDTFSRSHLSRVMSAALLVIVAAGCSNNAADATSNTDLVNSSKAKTST
AALSKDSDAKVVKSLQANLKASGIEETILSAVPTDMDDIYWVTAEGLPAFFTDKAGKHII
QGQIIAVGAKAPVDISGTLVARTAQDALKAVDKKDMVIYPAKGATKAVVYAFTDADCPYC
AKLHEEMEDINARGIEVRYLAWPRSEGSIPKMEAIWCSEDRKAAMDQAKMGANIQAPSCN
SPVQAQIDLGIALGVRGTPAIFTESGQQVGGYLPAAQLAEAVGAN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttcttagcgcctttttctaaaaccatgctcaaccgtgatacattttctcgcagtcat
ctctctcgtgtaatgagtgctgctttactggttatcgttgcggctggttgctctaataat
gctgcagatgcgaccagcaatacagatcttgtcaatagcagcaaagccaagaccagtact
gctgcgctatccaaggacagcgatgctaaggtagtgaagtcgttgcaagccaatttaaaa
gcttctggtattgaagagactatcctctcagccgtgccaaccgatatggatgatatttat
tgggtcaccgctgaagggctgcctgctttttttacagataaggcgggcaagcatattatt
caaggtcaaattattgctgttggcgcaaaagcccctgtagatatcagcggtactttggtc
gctcgtacggctcaagatgcactaaaagccgtcgataaaaaagatatggtcatctatccc
gccaaaggcgcgactaaagctgtggtttacgcctttaccgatgccgattgtccttattgc
gccaaactccatgaagagatggaagacatcaatgcgcgtggcattgaagtgcgttatttg
gcatggccacgtagtgaaggcagtattccaaagatggaagccatctggtgtagcgaagac
cgcaaggcggcaatggatcaagcaaaaatgggcgccaatatacaagcccctagctgtaat
agccccgtccaagcgcaaattgatctaggcatagcactgggtgtacgtggtacgcccgct
atctttactgaatcaggacagcaagtgggtggctatctacctgcggctcaattagcagaa
gcagttggtgctaactaa

DBGET integrated database retrieval system