KEGG   Psychrobacter arcticus: Psyc_0432Help
Entry
Psyc_0432         CDS       T00256                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
par  Psychrobacter arcticus
Pathway
par00260  Glycine, serine and threonine metabolism
par00400  Phenylalanine, tyrosine and tryptophan biosynthesis
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01130  Biosynthesis of antibiotics
par01230  Biosynthesis of amino acids
Module
par_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyc_0432 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyc_0432 (trpB)
Enzymes [BR:par01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psyc_0432 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAZ18295
UniProt: Q4FUL3
Position
541376..542650
Genome map
AA seq 424 aa AA seqDB search
MSHVANKDLSTTAQTINTFTNPESVQDFNQYPDARGHFGVHGGRFVSETLMAALEELETL
YNKVKVDPKFWEEYHNDLVNYVGRPTPLYHAKRLSDEIGGAQIYFKREDLNHTGAHKVNN
TIGQALLAKMSGKKRIIAETGAGQHGVATATIAARLGLECIVYMGADDVERQKMNVYRMR
LLGATVVPVTSGSRTLKDAMNEAMRDWVTNVDSTYYIIGTVAGPHPYPLLVRDFQAIIGK
EARIQHLQMTGKLPDALVACVGGGSNAIGLFFDFLNDTEVKMYGVEATGDGIETGRHSAP
LAAGRIGVLHGNRTYLMADDEGQIQETHSISAGLDYPGVGPEHSFLKDMKRVEYVGCTDK
ESLEGFHEVTRKEGIIPALESAHAVAYALKLAKTMTPDQTIIVNMSGRGDKDLHSVMKAE
GIEL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgtcgctaacaaagatttatctactaccgcacaaactatcaatacctttacc
aatccagaaagcgtgcaagattttaaccagtatcccgatgcgcgtggacattttggcgtc
cacggtggacgctttgtgtctgaaaccctgatggcagcgttagaagagctagaaacgtta
tataataaagtcaaagtagatcctaagttttgggaagaatatcacaatgatttagtcaat
tacgtcggacgcccaacgcctttgtatcacgccaagcgtttaagtgatgagattggcggt
gcgcaaatttacttcaagcgtgaagacctcaatcatactggcgcgcataaggtgaataat
accattggacaagcgttacttgccaaaatgagtggcaaaaaacgtattattgcagagact
ggagcagggcaacatggtgttgcaacggcgacgattgctgcgcgtttgggactggaatgt
atcgtttatatgggcgctgatgatgttgagcgccaaaaaatgaacgtttaccgtatgcgc
ttgctgggtgcgacggttgtgccggtgacatctggctctcgtacacttaaagatgcgatg
aatgaagccatgcgcgactgggtcaccaatgtcgatagcacgtattatattattggtacg
gttgcaggtccgcatccttatccgctactcgtgcgtgatttccaagcgattattggtaaa
gaagcgcgtattcaacatttacaaatgactggtaaattaccagatgcgctggtggcttgt
gttggcggtggttctaacgccattggtctgttctttgacttcttaaatgatacggaagtt
aaaatgtatggcgttgaagcaacaggtgatggtattgaaaccggtcgccattcagcacca
cttgcagcaggtcgtatcggtgtattacacggtaaccgtacgtatttgatggcggatgac
gagggtcaaattcaagaaacgcattctatctcggcaggtcttgattatcctggcgttggt
cctgagcatagcttcttaaaagatatgaagcgtgttgaatatgttggttgtacggataaa
gaatcgctagaaggcttccatgaagtcacgcgtaaagagggtatcatccctgcgcttgaa
tctgctcacgccgttgcttatgcgctgaagctcgctaagaccatgacccctgaccaaact
attattgtcaatatgtcaggtcgcggcgataaagatttgcattctgttatgaaggcagaa
ggcattgagttgtag

DBGET integrated database retrieval system