KEGG   Psychrobacter arcticus: Psyc_0433Help
Entry
Psyc_0433         CDS       T00256                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
par  Psychrobacter arcticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psyc_0433 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyc_0433 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyc_0433 (trpA)
Enzymes [BR:par01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psyc_0433 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
542793..543629
Genome map
AA seq 278 aa AA seqDB search
MTRIESTFEILKAQNKKALIPYVMAGDPNPSNFVGLLHDLVKHGADMIEVGLPFSDPMAD
GPTVALAGERALAAGTSTRDALKMVAEFRQQDTQTPIILMGYLNPVEIIGYDNFVALCEQ
SGVDGILMVDLPPAEAGSFTQHLTEHSMNEIFLLSPTTLPERREQVLTHCGGYIYYVSLK
GVTGSATLDTDDVATQVQAIKAETDLPVCVGFGIRDAASAKAIGAHADGIIVGSALVQNF
ADIDGNDATAVAHAQQKIMAKMTELREALDSLSVSSNG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtattgaaagcacttttgaaattttaaaagcacaaaataaaaaagcactcatc
ccttatgtgatggcaggcgaccctaatcctagcaactttgttggcttgctacatgattta
gtcaagcacggcgcagatatgattgaagtgggcttgccattttctgacccaatggcagac
ggtccaaccgttgcactggcaggcgagcgtgcattagcagcgggcaccagtactcgtgat
gcgctaaagatggtcgcagagtttcgtcagcaagacacgcagacgcccatcattttgatg
ggttatctgaatcccgttgaaatcatcggttatgataacttcgttgcgctatgcgagcag
tcaggggttgatggcatcttaatggttgatttgccaccagcagaggcgggtagctttact
cagcatttgactgagcactcgatgaatgagattttcttactctcaccgactaccttacct
gagcgccgtgagcaagtattgacccattgcggtggttatatctactacgtgtctttgaaa
ggtgtcacgggttcggcaacgctagatactgacgatgtcgcaacccaagtgcaagccatt
aaagcagagacggatttgccagtatgtgtgggttttggtattcgtgatgcggcgtcagcc
aaagcaatcggtgctcatgctgatggcattatcgtcggtagtgcattggtgcagaacttt
gctgatatcgatggtaatgatgccacggctgttgcacatgcacaacaaaaaatcatggca
aaaatgactgagctacgcgaggcattagatagtttaagcgtttcttcaaatggctaa

DBGET integrated database retrieval system