KEGG   Psychrobacter arcticus: Psyc_0668Help
Entry
Psyc_0668         CDS       T00256                                 

Gene name
wbpS
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
par  Psychrobacter arcticus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psyc_0668 (wbpS)
Enzymes [BR:par01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Psyc_0668 (wbpS)
Peptidases [BR:par01002]
 Cysteine Peptidases
  Family C44
   Psyc_0668 (wbpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791494..793449
Genome map
AA seq 651 aa AA seqDB search
MCGVNGFFNAHTTIPVQNVIAQMNAAIDHRGPDAGDAWLDENIGLVLGHQRLAIQDLSPA
GAQPMHSACGRYVLAFNGEIYNHLQLREQLMIEGHAPAWRGHSDTETMLACFVAWGIEKT
LQAMVGMFAIVLWDRQQKVLTLARDRMGEKPLYWGWQGQSLYFSSELKGLKAHPSFKTDI
NRDAITLLLRHNCIPAPYSIYQGIEKLRPGHWVQLPLSDIQQAKTAQSKAYWRFNDIVEA
GLADPFTGSPEQAVDALESALMQSIGGQMQSDVPLGAFLSGGIDSSTVVALMQAQSSRPV
KTFTIGFDDAGYNEATHAKAIAKHIGTEHTEMYMRPEDALAVIPKLSSIYCEPFSDSSQI
PTFLVNQLAHQHVTVALSGDGGDELFGGYNRYLMAQQVWSKSRKLPRPMRQLAAVSLTAL
SPKSWDTLVNTLSPVIPKRLNLRTPGDKAHKLAGVLNIDSEQAFYQNLTSHWQDPAQLVI
GAQEPATLISDSSCWPTTDSFQHAMMAMDAQTYMTDDILVKVDRAAMANSLETRVPMLDH
RIAELAWRMPLDYKIRNGEGKWLLKQVLYRHVPRELIERPKMGFGIPLHDWLRGSLRDWA
EALLDRNLLQQQGYFNPAPIRKIWNEHLSGVFNHQHQLWDILMFQAWLETQ
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtgtaaacggttttttcaatgcgcacacaacgatacctgtgcaaaatgtcata
gctcagatgaatgccgctatcgatcatcgtggcccagatgctggtgatgcttggttggat
gagaatattggtttggttcttggtcatcagcgtttggctatacaagatctttccccggca
ggcgcacagcccatgcactctgcttgtgggcgatatgtgctagcatttaatggcgaaatc
tacaatcatttacaattgcgtgagcagcttatgattgaaggtcatgcacccgcttggcgt
ggtcattcagatacagaaactatgctagcctgctttgtcgcttgggggatagaaaaaact
ctacaagcgatggtaggtatgttcgccattgtactgtgggatcgccagcaaaaagtattg
acgctagctagagatcgaatgggtgaaaagcctctatattgggggtggcaaggacagagc
ctatactttagctctgagttaaaaggactcaaagcgcatccttcgtttaaaactgatatt
aatcgtgatgcgataactctactattacgacacaattgcattcccgctccttatagtatt
tatcagggtatcgaaaagctgcgtcctggacattgggtgcaattgcctttatctgatata
caacaagctaaaacagcgcaatcgaaagcctactggcgttttaatgatatcgttgaagca
ggtttagcagatccatttacaggaagtccagagcaagcagttgacgctttagagtctgca
ctgatgcaaagcatcgggggacagatgcagtctgatgtgccacttggggcttttttaagt
ggcggtattgatagcagtacagtagtggccttgatgcaagcgcaaagttcacgcccagta
aagacctttactatagggtttgatgacgcaggttataatgaggcaactcatgcaaaggct
attgctaaacatataggtactgaacatactgaaatgtatatgcgccctgaagacgctcta
gcggtaatacctaaattatcttctatatattgcgagccattttccgacagctcgcagatt
ccgacctttttggtgaatcagttagcacaccagcacgtgacggtggcgctcagcggtgat
ggtggtgatgaattatttggaggttataaccgctatcttatggctcagcaggtttggagt
aagagtcgcaagttgcctaggccgatgcggcagctagcagccgttagtcttactgctttg
tcacccaaaagctgggatacattggttaatacgcttagtccggtaatacctaaacgccta
aatttacgtactcctggggacaaagcccataagctagcaggtgtccttaatatcgatagc
gaacaagccttttatcagaacttaaccagtcattggcaggatccagctcaattagttatt
ggtgcacaagaaccagcaaccctaatcagtgattcaagttgctggccgacaacagatagc
tttcagcatgccatgatggctatggatgcgcaaacttacatgacagatgatatattggtt
aaagttgatcgtgcggcaatggccaatagcttagagacccgagtgccaatgcttgatcat
cgtatcgctgaactcgcttggcgtatgcctttagattataaaatacgtaatggtgaaggt
aaatggttgctgaagcaagtattatatcgtcatgtgcctcgcgaattaattgaacgtcct
aaaatgggttttggtatacctctgcatgattggctacgaggttctttacgtgattgggct
gaagccttgcttgatagaaatcttttgcagcagcaagggtattttaatccagcgccaatc
cgtaagatttggaatgaacatttgagcggcgtatttaatcatcaacatcagctatgggac
atacttatgtttcaggcatggcttgaaacgcaataa

DBGET integrated database retrieval system