KEGG   Psychrobacter arcticus: Psyc_0717Help
Entry
Psyc_0717         CDS       T00256                                 

Definition
bifunctional HTH-domain containing protein/aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
par  Psychrobacter arcticus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Psyc_0717
   01230 Biosynthesis of amino acids
    Psyc_0717
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psyc_0717
   00290 Valine, leucine and isoleucine biosynthesis
    Psyc_0717
Enzymes [BR:par01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Psyc_0717
    2.6.1.66  valine---pyruvate transaminase
     Psyc_0717
Amino acid related enzymes [BR:par01007]
 Aminotransferase (transaminase)
  Class I
   Psyc_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(853728..855368)
Genome map
AA seq 546 aa AA seqDB search
MMADDKTKSTQAERLVQLRRDKGMTAEQLAQAMTAAGAKVSRGAISNWERGTNGIVSSKL
PTLARILGCSEGYLLRGELESDSKSDVDLKNIASDNTNVYVESDEQAHSASQITHTTTIP
STPRKISPNNLMSGPFMNTIKKSDKLQNVCYDIRGPLLQTANKMEAEGKRILKLNIGNPA
PFGLEAPHEILRDVAMNLPEATGYSDSQGIFSARKAVLQYYQSKGLLSAVDVRDVYLGNG
VSELIVMTLQALMNDGDEVLIPMPDYPLWTAATNLAGGTAVHYRCNEEDNWHPDIEDIKS
KITSKTKGIVVINPNNPTGALYSDEVLLQIIEVAKEHDLIIMADEIYDRILYDDMEHTPM
STLTDEVLVLSYNGLSKSHRIAGFRAGWMMISGRKEHAADFIEGLDMLASMRLCSNVQGQ
YAIQTAMGGYQSMKDLTSKKGRLYKQRELAVTRLNAIKGISCTMPQGAFYCFPKMDPEIY
PIKDDMQFMMDLLLEENVLMVQGTGFNWDKHDHFRLVFLPNLHDLEDAMDRLDRFFAKKR
KQFGTD
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgatgacaagactaaaagcacacaagctgaacgactggtacagctgcgccgt
gacaaaggaatgacggcagagcagttggcacaagcgatgactgctgctggcgctaaagtc
agtcgtggtgccatctctaattgggagcgtgggacgaatgggattgtctcatctaagcta
cctactctcgcgcgtattttaggctgtagcgaaggatatttattgcgcggtgagcttgaa
agtgacagcaaatcagatgtcgatttaaagaatatagcgtcagacaataccaacgtatat
gtcgaatccgatgagcaagctcatagtgccagtcaaatcacacacacaacgacaataccc
tctactccccgcaaaatttcaccaaataacctgatgagtggtccctttatgaatacaata
aaaaaatccgataaattacaaaacgtctgctacgacattcgcggtcctctgttgcaaact
gccaataaaatggaagcagaaggcaaacgtattttaaagctgaatattggcaatcccgct
ccttttggtttagaagcaccgcatgagattttgcgtgatgtggcgatgaatctgccggaa
gcgacgggctattcagactcgcaagggattttttcagcgcgtaaagcggtattgcaatac
tatcaatcaaaagggcttctatcggcagttgatgttcgtgatgtttacctaggtaatggc
gtctctgagctgattgtcatgaccttgcaggcactgatgaatgatggcgatgaagtattg
attccaatgccagactacccgctttggacagcagctaccaatctagcaggcggtacagcg
gtacattatcgctgtaatgaagaagacaactggcatcctgatattgaagacatcaaatct
aaaatcactagcaaaaccaaaggcattgtggttattaatcccaataatccgacaggcgca
ctttatagtgatgaagtactgctgcaaattatcgaggtcgcaaaagagcatgatttaatt
attatggccgatgaaatttatgaccgtattctttatgacgatatggaacatacgccgatg
agtaccttgaccgatgaagtactggtgttgtcctataatggtttgtcaaaatcgcatcgc
atcgcaggctttcgtgccggttggatgatgatctcaggtcgcaaagaacacgccgctgac
tttatcgaaggtttggatatgctcgcctctatgcgtctatgttctaacgttcaaggacaa
tatgcgattcagacagccatgggcggctatcaaagcatgaaagacttaacttctaaaaaa
ggtcgcttgtacaagcagcgcgagttggcagtgacccgccttaatgcgatcaaaggtatt
tcttgtaccatgccacaaggcgcgttttactgctttccaaagatggatcctgagatttac
cctatcaaagatgatatgcagtttatgatggatttattgttggaagaaaacgtattgatg
gtacaaggaacagggtttaactgggacaaacatgaccatttccgcttggtatttttaccc
aacttacacgatttagaagacgccatggatcgcttagaccgcttctttgctaaaaagcgt
aagcaatttggtaccgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system