KEGG   Psychrobacter arcticus: Psyc_0794Help
Entry
Psyc_0794         CDS       T00256                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
par  Psychrobacter arcticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:par00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psyc_0794 (recR)
DNA repair and recombination proteins [BR:par03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Psyc_0794 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949693..950286
Genome map
AA seq 197 aa AA seqDB search
MLTAKFDQLVKQLRILPGVGQKSAQRMALHLLTKKRPQGMALAQALDEAMRDIVECQRCH
SFSDDAVCPLCQDPRRDDALLCVVETAADVMAIEQTAGYRGRYFVLGGHLSPIDGISADD
LNIEQLVWRVKQEPVEELILATGTTVEGQTTAHFINEAVSRHVNKVTRLAQGVPMGGELE
YLDSMTLGQAMQNRSFL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgctgacagccaaatttgatcagctggtcaaacagctgcgtattttgccgggcgttggt
caaaaaagcgcccaacgtatggcgctgcatttgctcaccaaaaaacgcccacaaggcatg
gcgctcgctcaagcacttgatgaggcaatgcgtgatattgtagaatgtcagcgctgccat
agctttagcgatgatgccgtttgtccgttatgccaagatcctaggcgtgatgacgcatta
ttgtgtgtggttgagacggcagcggatgtcatggcgatagagcaaactgcaggttaccgt
gggcgttattttgtgttgggtggtcacctgtcaccgattgacggaattagcgcggatgat
ttaaatattgagcaactggtctggcgcgtcaagcaagagcctgttgaggagttgatattg
gcgaccggcactacggtcgaagggcaaacgaccgcgcattttatcaatgaggcagtcagt
cgtcatgttaataaagtaacgcgtttggcgcaaggtgtccccatgggcggcgagcttgaa
tatcttgatagcatgacccttggacaagcgatgcaaaaccgctcctttttatag

DBGET integrated database retrieval system