KEGG   Psychrobacter arcticus: Psyc_0821Help
Entry
Psyc_0821         CDS       T00256                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
par  Psychrobacter arcticus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:par01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:par00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:par00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:par00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:par00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985662..987371
Genome map
AA seq 569 aa AA seqDB search
MNTFSQETSSTETAVNTVNTITSYSDYYHNFDINTLLTEIFGEHLDDRLNAYMACCGRHV
RDGRGDNIALVHEDMAGHVTRMSFAELDKASAQVASLLLSYGVQAGDQVATMLPRTPELL
TIVLATWRIGAVYQPLFTAFGYDSIKYRMDKANTKVVFTNQENRGKFDDLAKQSKMVLVG
SKVDAQSWGDDNYAERISKQPQTIEPVLLNTDAPFLQMFTSGTVGKSKGVSVPLSALSAF
YLYMRYAIDLRADDNYWNMADPGWAYGLYYAITGPLLLGVTTYFNEAGFDAENTRDFMVR
HKISNLASSPTAFRMMKSSGVFESAHNDPEAKLSLRCANSAGETLNTEVVNWVENYLNCK
VCDQYGQTETGMTCCEHHALDHECPVGSMGMALPGHTLVVLDDDMKVLADGEQGQLAVVV
SQSPAFYFRGYNWNEKDAFVNDYYLTGDVVERHSDGSYWFSGRDDDIIITSGYRVGPTDV
ENTVLEHEAVAESAAVGVPDEVRGHTIKSYVVLKDGIEGTAEIAKEIQDLVRRRLSTHAY
PREVEFVTALPKTPSGKIQRFLLRSLSAA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaataccttctctcaagaaacttcatctacagaaactgcagtgaataccgtcaataca
ataacgagctacagtgattattatcataattttgatatcaatacattattgacagaaata
tttggcgagcatttagatgatcgtttgaatgcttatatggcgtgttgcggtcgtcatgta
cgtgatggtcgcggtgacaatatcgcactggtacatgaagatatggcgggccatgtgact
cgtatgagttttgctgaactggataaggcaagtgcgcaggttgccagcttattactttct
tatggcgtgcaagcaggtgaccaagtggcgactatgctgccgcgcacgcctgaattacta
accattgtattagccacttggcggattggcgcagtatatcaaccgctgtttaccgctttt
ggttatgattcgattaagtatcggatggacaaagccaatactaaagttgtttttaccaat
caagaaaatcgtggcaagtttgacgacttggccaaacaaagcaagatggtattggttggc
agcaaggtagatgcgcaaagttggggtgatgataattatgctgaaaggatatcaaagcag
ccgcaaacgatagaaccagtattactgaataccgatgcgccctttttacagatgtttacc
tcgggcacggtgggcaaatcaaaaggcgttagcgtgccactaagtgcactctcagctttt
tatctatatatgcgttatgcgattgacttgcgcgcagatgataactattggaatatggca
gatccaggttgggcgtacggtctttactatgcaattacaggacctttattattaggggtg
acgacgtattttaatgaagctgggtttgatgcggaaaatactcgtgactttatggtacgt
cataagattagtaatttggcatcctcgccgacggcatttcgcatgatgaaatcgagtggc
gtgtttgaaagtgctcacaatgacccagaggctaaattatcactgcgctgtgccaattca
gcaggtgagaccttaaataccgaagtggtcaattgggttgaaaactatttgaactgcaaa
gtttgtgatcagtatgggcagacggaaacagggatgacgtgttgcgagcaccatgcttta
gatcatgagtgcccagttggctcgatgggtatggcactaccggggcatacacttgtggtg
ttagatgatgatatgaaggtactcgctgatggtgaacaagggcagctggcagtggtagtc
agccaatcgccagcattttatttccgtggttataactggaatgagaaagatgcattcgtg
aatgattattatctaacaggcgatgtggttgagcgtcatagcgatggcagttattggttc
tctgggcgtgatgatgacattattattacgtcaggctaccgagtaggtcctaccgatgtc
gaaaataccgtgcttgaacatgaagccgtcgcagagtcggctgctgtcggtgtacctgat
gaagtgcgtggtcataccatcaagtcttatgtggtactaaaagacggtatcgaagggacg
gcagagattgccaaggaaattcaagacttggtacgcagacgtctctcgacgcatgcttat
ccacgtgaagttgagtttgtgacagcactaccaaagaccccaagtggtaagattcagcgt
tttttgttgcgtagtttatcggcagcataa

DBGET integrated database retrieval system