KEGG   Psychrobacter arcticus: Psyc_0972Help
Entry
Psyc_0972         CDS       T00256                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
par  Psychrobacter arcticus
Pathway
par00400  Phenylalanine, tyrosine and tryptophan biosynthesis
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01130  Biosynthesis of antibiotics
par01230  Biosynthesis of amino acids
Module
par_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyc_0972 (trpC)
Enzymes [BR:par01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psyc_0972 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DUF769
Motif
Other DBs
NCBI-ProteinID: AAZ18825
UniProt: Q4FT33
Position
complement(1166151..1167038)
Genome map
AA seq 295 aa AA seqDB search
MTTNTTVRSNIPSVLQRIVATKHDEVAAARKLLSLEDLQEKVAADKQPRRGFASALRGAD
IGIIAEIKKASPSKGIINHNFAPALFAKQYEQAGASCLSVLTDRDYFQGDDSYLIQAREA
CRLPILRKDFMIDVYQIYQSYLLGADCILLIMACLDDAQVQELHALSIELGMDVLIEVHT
AEELERALRLPHSEHNIYGINNRDLNTFDVDLQTTLDLKNALLRELAIDDAFSANPNDSL
QRPLIVTESGIHSSNDIRMMLSHNIQHFLIGEQFMKTDHPGQALQSLLASVAAQA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaatacgacagtccgctcaaatattccttcagtattgcagcgtatcgttgct
accaaacatgacgaagtggctgctgctcgtaagttgttatcacttgaagacttacaagag
aaagtcgcagcggataaacaacctcgtcgcggttttgctagtgccctgcgtggcgctgat
atcggtattattgctgagataaaaaaagcctcgccttctaaaggtattatcaatcacaac
tttgctcctgccttatttgctaagcagtatgagcaagcaggcgcaagctgtctgtctgtt
ttgactgatcgtgactacttccaaggtgatgatagctatttgatccaagcacgtgaagct
tgtcgcctaccgatattacgtaaagactttatgattgatgtctatcagatttatcagtca
tatctactcggcgcagattgtatattactgattatggcgtgccttgatgatgcacaggtg
caagagctgcatgcgctaagcatcgagcttggtatggatgtgttgatagaagtgcatacg
gcagaagagcttgagcgtgccctacgattgccacattcagagcacaacatctacggtatc
aataaccgtgatttaaatacctttgatgtggatttgcagacgacacttgatttaaagaac
gccctattacgcgagcttgccattgatgatgcattttctgccaatcccaatgacagtcta
caacgtccgcttattgtgactgagagtggcatccatagcagtaatgatatccgtatgatg
ttaagccataatatccagcattttttaatcggtgagcaatttatgaagaccgatcatccc
ggacaagcattacaatccttacttgcgagcgtcgcagcacaggcgtaa

DBGET integrated database retrieval system