KEGG   Psychrobacter arcticus: Psyc_1032Help
Entry
Psyc_1032         CDS       T00256                                 

Definition
bacteriophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
par  Psychrobacter arcticus
Brite
Enzymes [BR:par01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Psyc_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221190..1221807
Genome map
AA seq 205 aa AA seqDB search
MSHDEFFKWLKSKQGNGKLTQTQVDGANAVLSVVRADVLQDFISALTGWSVNDDRAMSKE
GIDLLKFYEGLKLKAYQDTGKVWTIGYGHTSASGGMKVYQGLVITREQAEQLLKDDLARM
TYPVVDDLVKVPLTQGQFDAMCSFIYNLGEGQVSKSTLLRLLNAKDYKGASTQFGRWVFD
NGVELDGLIARRAAERKLFASSGDL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgatgagttttttaaatggttgaaatcaaaacagggcaacggcaagctgacg
caaacgcaagttgatggcgcgaatgcggtcctatcggtagtcagagctgatgtgctgcaa
gattttatatcggcgcttaccgggtggtctgttaacgatgatcgtgcgatgtcgaaagag
ggtattgacctactcaagttttatgagggcttaaagctaaaagcctaccaggataccggt
aaggtttggactatcggctatgggcacacatcggcttctggcggtatgaaagtctatcaa
gggcttgtaatcacacgcgagcaagcagagcagttattaaaagacgacttggcgcgtatg
acctatcctgtcgttgacgacttggtaaaagtgccattaacacaaggtcagtttgatgct
atgtgctcgtttatctacaatcttggcgaagggcaggtaagtaaatcaacattgctacga
ctgctaaacgcaaaagactataaaggcgcgtccactcagtttggtagatgggtttttgat
aacggcgttgagctggacggcttgattgctcgtagagcagcagagcgcaaactttttgcc
tcatctggtgatttatga

DBGET integrated database retrieval system