KEGG   Psychrobacter arcticus: Psyc_1042Help
Entry
Psyc_1042         CDS       T00256                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
par  Psychrobacter arcticus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Psyc_1042
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyc_1042
  Lipid metabolism
   00071 Fatty acid degradation
    Psyc_1042
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psyc_1042
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyc_1042
   00626 Naphthalene degradation
    Psyc_1042
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psyc_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1233479..1234804
Genome map
AA seq 441 aa AA seqDB search
MKKQNSIAKLVSSKLVSSNGLQYTGYLAVAKTRAKVLKAFAYIIPIRRPMLFVGESSCDE
LCDMLINEGSTNVFIVTDGVLNKLGIPAKVTDYLDSKNISYKVYDGITPDPTFKVVEEGL
RISVDAKCDSIIAIGGGSVIDAAKMIAMSQGNNCKPQQLIGILKARKPSVPLYCVPTTAG
TGSEATLGAVVSDDKTHQKALSIDPRMVPLAAAIDPVIMKGMPAHITADTGIDVLTHALE
AWMSANASVETDYYAASAVKSVMQNLPIVYEDGGNLKAREAMGIAAHYGGIAFNKAGLGY
VHAIAHQLGAYYSIPHGRANAIVLPYVLDVNRQASKKRLAELARKTGMVKSGQASSSDSD
IADYLIAQVRELIATLNIDPTVKGMKASDFDSIAKAAAKEVSDTYAVPTYLSASEIKDIL
LKIKQASEDAAGTDAKNDKVA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaaacagtattgctaaattagtaagtagcaaattagtcagtagcaatgga
ttacagtatactggctatttagctgttgccaagacacgcgccaaagtactaaaagccttc
gcttatattattccgattagaagaccgatgttattcgtcggcgagagctcttgtgatgag
ctatgcgatatgctcattaatgaaggtagcaccaatgtctttatcgtgactgatggagtg
ctaaataagctcggcataccagccaaagtcactgattatctagatagtaaaaatatcagc
tataaagtctatgacggtattacaccagaccctacttttaaagtggttgaagaaggacta
cgcatatccgttgatgctaaatgcgattcaattattgcaatcggcggtgggtcggtcatt
gatgcagctaaaatgatagccatgtcacaaggcaacaattgcaagccgcagcagcttatc
ggcattcttaaagcaagaaagccttctgtaccgttgtactgtgtgcctacaactgctggt
actggttcggaagcgacacttggtgcggttgtatcagacgataaaactcatcaaaaagcc
ctatctatcgatccaagaatggtgccattagcagcggctattgacccagttatcatgaaa
ggtatgccggctcatatcacagcggatacgggtatcgatgtgttgacacatgccctagaa
gcttggatgagtgccaatgctagcgtagagactgattattatgctgcctctgcggttaag
tcagttatgcagaatctgccaatagtatacgaagacggcggcaatctcaaagccagagaa
gcaatgggtattgcggctcactacggcgggattgcctttaataaagcaggccttggttat
gtccatgccatcgctcatcagctaggggcgtattatagtattcctcatggtcgcgccaat
gccatcgtgttaccttatgtacttgatgtcaatcgtcaagcgagcaaaaagagattggct
gagctggctagaaaaacgggcatggtaaaatctggtcaagctagcagcagtgatagcgat
atcgccgattatctcatcgcccaagtacgtgaattgattgcaaccttaaacatcgatcca
acagttaaaggtatgaaagccagtgattttgatagtattgctaaagcagcggctaaagaa
gtcagtgatacttatgcggtaccgacttatctgtcagcgtctgaaataaaagatatctta
ttgaagattaagcaggcaagtgaagatgctgctggtactgacgctaaaaatgataaagtt
gcatag

DBGET integrated database retrieval system