KEGG   Psychrobacter arcticus: Psyc_1044Help
Entry
Psyc_1044         CDS       T00256                                 

Gene name
folE2
Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
par  Psychrobacter arcticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psyc_1044 (folE2)
Enzymes [BR:par01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Psyc_1044 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1236323..1236934)
Genome map
AA seq 203 aa AA seqDB search
MAAKLMSNTATIASDYQESIESYRQLIASTGEDLHRPGLEDTPTRAAKAFAHLTKGYHQS
LDEVVNGAVFPSTNRELVLVQNIEFYSLCEHHMLPFHGVAHIGYLPNGQVLGLSKFARIV
DMFARRLQIQENLSEQVAQTIMDVTGCRGVAVVMDAAHMCMMMRGVNKQHSTTRSTAMLG
EYVHDNQARNEFLDAVPKRRPAF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaacttatgagcaataccgcaacaatagcatcagattatcaagaaagcatc
gaatcctatcgtcagctcatcgcctcaacgggtgaggacttgcatcgtccaggacttgaa
gacaccccaacacgtgccgccaaagcgtttgcgcatttgaccaaaggatatcatcaaagc
ttagatgaagtggtcaatggcgctgtatttccatcgaccaatcgcgagttggttttagta
caaaatattgaattttattcattatgtgagcatcatatgttgccttttcatggtgttgcg
cacattggttacttaccaaacggtcaagtattaggactgtctaaatttgctcgtatcgtc
gatatgttcgctcgtcgtttgcaaattcaagagaatttgagtgagcaagtggcacaaact
attatggatgtgactggctgtcgcggtgtagctgtggtaatggatgcggcccatatgtgt
atgatgatgcgcggtgttaataagcagcactccactacgcgtagtacggctatgctaggt
gagtatgtacatgataaccaagcacgcaatgagtttttagatgctgtaccaaagcgtaga
cctgctttctaa

DBGET integrated database retrieval system