KEGG   Psychrobacter arcticus: Psyc_1181Help
Entry
Psyc_1181         CDS       T00256                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
par  Psychrobacter arcticus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:par00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1416597..1417130)
Genome map
AA seq 177 aa AA seqDB search
MTHKALADLFESLTSCEPEGLQAQPISAVLLALGSNHDADIHLPRVRKCLANLGDITLST
AFQNPDFTATMELPKPDYTNQCVYLSLATPITLQELQQTFKQFECECERQRLTELPTGIK
QVTMDIDILLVKLAKKNSLSKNKEFEWSKWITMADRHPFKAHERAGIEELKAGIDSV
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacgcataaagccttggctgatttatttgagtcattgacaagctgtgagcctgaagga
ttgcaagcccagcctatatcagcggtgctactggcattgggtagcaaccatgatgcggac
attcacttaccgcgtgtccgaaagtgtttggcgaatctcggtgatataacgctgtcgaca
gcttttcaaaaccctgactttactgccaccatggaactgccaaaacctgactacaccaat
cagtgcgtttatttgtctttagcgacacccataaccttgcaggagctgcaacaaaccttt
aaacagtttgagtgtgaatgcgagagacagcgtttaacagaactaccgacaggtataaaa
caagtaacaatggatattgacatactgcttgttaaactggctaaaaaaaatagcctaagc
aaaaataaagaatttgaatggtccaaatggataacaatggcagatcgccatccatttaag
gcacatgagagagcagggatagaagagttaaaagcggggatagatagcgtataa

DBGET integrated database retrieval system