KEGG   Psychrobacter arcticus: Psyc_1332Help
Entry
Psyc_1332         CDS       T00256                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
par  Psychrobacter arcticus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Psyc_1332
Enzymes [BR:par01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Psyc_1332
Exosome [BR:par04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyc_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1608917..1610533)
Genome map
AA seq 538 aa AA seqDB search
MAGYILALDQGTTSSRAILYDDHACPIKMAQQPTILKTPQAGFVEQDAQQIWQTQISCAH
DVINQAGLLATDVSGIAITNQRESIVIWDKHTGKPLAPAIIWQDRRTASYCQLLADENLM
ATTQVVTGISNNSSQGNMASEVQRITGLRLDPYFSASKIAWLLEHNPKLSVRASKGEIAV
GTIDSWLIYKLTGGEHVIDVTNASRTLLYDIHKLAWSEELCARFGIPINILPKVLPSDGD
FGKTKKGLFAKQIPIHAVLGDQQAALFGQGCLEAGMAKNTYGTGCFMLMNIGQKPMLSEH
KLLTTIAWQRKSAPTRPDHLSFEQIVQSGKRMLQPPNREVTYALEGSVFMAGAIVQWLRD
NLGMFQKSGEVEDLARQVESSEEVVLLPAFTGLGAPYWRSDISASITGMSRGTTKAHIAR
AALEAIAYQTYDVLIAMQKDSPQALTELRVDGGAANNDLLMQFQADLLGVPVLRPKDTEI
TAKGVALLAGLKTGLYDDTTMQASWQVDRIFEPSMSIDVREQHLNKWQQAISRALMTP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatatattttagctttagatcaagggacaacctcgagtcgagcgatattgtac
gatgatcatgcgtgcccaattaaaatggcacaacagccaacgattttaaaaacgccgcaa
gcaggctttgttgagcaagatgcccagcaaatttggcagacgcaaatcagctgcgcccat
gacgtcattaatcaggcggggctgctcgctaccgatgttagtggtattgcgattaccaat
cagcgtgagtctattgtcatatgggataagcacacaggtaagccgcttgcgccagccatt
atttggcaagacagacgtacggcgagttactgtcaattgcttgctgatgaaaacttaatg
gccacgacgcaagttgttacaggtattagcaataacagcagccaaggcaatatggcaagt
gaagtacaacgtatcacaggtttgcgcttagatccgtattttagtgccagcaaaatcgct
tggctattagagcacaaccctaagttgagcgtacgcgccagtaaaggtgagatagcggtt
ggcacgatagacagctggctgatatataagctaacaggcggtgagcatgtcattgatgta
accaacgcttctcgtaccttgttatatgatatccataagctggcatggtcggaggagttg
tgtgcccgatttggtatacccataaatattttgcctaaagttctaccatctgatggcgac
tttggcaaaactaaaaaagggctgtttgctaagcaaattcctatacatgcggtattgggc
gatcagcaagcggcgctttttgggcaaggctgtcttgaggcaggtatggcaaaaaatact
tacggtacgggctgttttatgttgatgaatatcggtcaaaaaccgatgcttagtgagcat
aagctattgacgaccattgcatggcaacgaaaatcagcaccaactcgtcccgaccattta
tcatttgagcaaatcgtgcaatctggtaaacgtatgctacagcctcccaacagagaagtg
acttatgcgttagaaggcagtgtatttatggcaggcgcaatcgtacagtggctgcgtgat
aatctgggtatgttccaaaagagcggggaagtggaagatttagcgcggcaagttgagagt
agtgaggaggtagtgttactaccagcatttacgggactgggtgccccttattggcgctca
gacatcagtgccagtattactggtatgagccgcggtacgaccaaagcgcatattgcacgg
gcggcattagaggctattgcttatcagacgtatgatgtgctcatcgccatgcaaaaagac
agcccgcaggcactcactgagctaagagtagatggcggcgcagcaaataatgatttgctg
atgcagtttcaagcagatttactaggcgtgccggtactacgcccaaaagacacagagatt
acagcaaaaggggttgcgttacttgctggtttaaagacaggtttatatgatgataccacg
atgcaagcctcctggcaggtggatcgaatttttgagcctagcatgtctatagatgtgcgt
gagcagcatcttaataaatggcaacaagctatcagtagagcgttaatgactccttga

DBGET integrated database retrieval system