KEGG   Psychrobacter arcticus: Psyc_1428Help
Entry
Psyc_1428         CDS       T00256                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
par  Psychrobacter arcticus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Psyc_1428
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Psyc_1428
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Psyc_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1727710..1728510)
Genome map
AA seq 266 aa AA seqDB search
MATQLQQDLTGKVALVTGAASGIGRDIAETYAKAGAAVGIADINLEAAQKTVDAIEAAGG
RALAIAMDVTSEAAVNDGVQRLVDTFGGIDILVSNAGIQIIDPIHKMAFEDWKKMLAIHL
DGAFLTTKAAIQHMYKDDKGGTVIYMGSVHSHEASLFKAPYVTAKHGLLGLCRVLAKEGA
VHNVRSHVICPGFVKTPLVEKQIPQQAAEKGISEESVVNDIMLVNTVDKEFTTVDDIAQL
ALFLAAFPTNVFTGQSIVASHGWFMN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccaattgcaacaggatttgaccggcaaagtggcattggtcacaggcgctgcc
agcggtatcggacgtgatattgccgaaacttatgccaaggcgggcgctgcggttggtatt
gcagatatcaatcttgaggctgctcagaaaaccgtcgatgctattgaagcagcaggcggg
cgtgcccttgcgattgcgatggatgtaacgtctgaagctgctgttaatgacggtgttcaa
agattggtcgatacctttggtggtattgatattcttgtctctaatgccggcattcaaatc
attgatcccatccataaaatggcgtttgaagattggaaaaaaatgctcgccattcatctc
gatggcgcgtttttgaccaccaaagctgccatacagcatatgtataaagacgataaaggt
ggcaccgttatttatatgggttctgtgcactcgcatgaagcttcattatttaaagcgcct
tatgtcaccgccaaacatggtctgcttggtctatgtcgggtattggcaaaagagggcgct
gttcataatgtacgctcgcatgtaatatgcccagggttcgtcaaaacacctttggtcgaa
aaacaaatcccacagcaagcggctgaaaaaggcatcagtgaagagtctgtggtgaatgac
atcatgctagttaataccgttgataaagagttcaccactgtcgatgatattgcccagttg
gccttatttttagcagcgttcccaactaatgtctttaccggacaatcaattgttgcaagc
cacggctggtttatgaattaa

DBGET integrated database retrieval system