KEGG   Psychrobacter arcticus: Psyc_1604Help
Entry
Psyc_1604         CDS       T00256                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
par  Psychrobacter arcticus
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:par00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981427..1982449
Genome map
AA seq 340 aa AA seqDB search
MQNKSIPSLPSMNRQPLGFFPTPLIELTRLSKALNGPKIYMKRDDNTGLALGGNKTRKLE
FIIGDALAQGADTIVTAGAAQSNHCRQTAAAAASLGLECHLVLGGQEPDQLNGNLLLDKI
FGCHIHWAGNNRKGEDIPDIVEQLENAGKKPYVVPYGGSSELGAFAFIEAFKELESQRQE
MDISFTHIVFASSSGGTQAGLMLGNKIFNSPYQIVGINIDKGETDKVPFDQYIVSLANST
AALIGADYSFSETDLMLNSDYVGDGYGVIGALENEAIAMTAQTEGILLDPVYTGRAMGGL
IDMIRTGKIKKTDSVLFWHTGGAPALFAYASALAVSQSDS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaatctataccaagcctgccgagcatgaatcgacaacctttaggatttttc
ccaacgccgttgattgagctgaccagattaagcaaagcacttaatggccctaaaatttat
atgaaacgagatgacaatacgggactggcattaggcggtaataaaaccagaaagcttgag
tttattattggggatgcacttgctcaaggtgcggatacgatcgtgacagcaggtgctgcg
cagtcaaatcattgtcgccagaccgcagccgccgcagccagtttgggacttgaatgccat
ttagttttgggcggacaagagccggatcagctcaatggcaatcttttactggataagatt
tttggctgtcatattcactgggcaggcaataatcgtaaaggagaagacattcctgatatt
gtagagcagctcgaaaatgcaggtaagaaaccctatgttgtcccttatgggggctcaagc
gagctgggggcttttgcctttatcgaagctttcaaagagcttgaatcgcaacgtcaagag
atggatatctcgttcactcatatcgtttttgcgtctagctccggtgggacacaagcgggc
ttaatgcttggcaataaaatctttaactcaccttatcaaatagtgggcatcaatattgat
aaaggtgaaacggataaagtaccttttgatcagtatattgtctcccttgccaacagcaca
gcagcattgatcggtgcagactatagcttttcagagacagatctaatgcttaattctgat
tatgtgggagacggttatggggttattggcgcattagaaaatgaagccattgccatgacc
gcgcaaacggaaggcatattattagatcctgtttatacgggtcgtgcgatgggcgggctc
atagatatgattcgtaccggtaaaatcaagaaaacggacagtgtgttattttggcatact
ggcggcgcgcccgctttgttcgcttatgccagtgctttagcggtgtctcaaagcgatagt
tag

DBGET integrated database retrieval system