KEGG   Psychrobacter arcticus: Psyc_1627Help
Entry
Psyc_1627         CDS       T00256                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
par  Psychrobacter arcticus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyc_1627 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psyc_1627 (aceA)
Enzymes [BR:par01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Psyc_1627 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2010478..2012064
Genome map
AA seq 528 aa AA seqDB search
MSTAYKSAIDLVRELKQKHGNWQNISETDAARMMSQNRFKTGLDIAKYTAKIMRQDMEEY
DNDTSQYTQSLGAWHGFVAQQTMYAKKKYFGTTSKTYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPKLIAEIYTFLRQADAKVLNDYFRELNAAEEAGQDTSAILEKIENFDSHVVPII
ADIDAGFGNEEATYLLTKQMIEAGACAIQVENQVSDAKQCGHQAGKVTVPHEDFISKINA
IRYAFLELGVEDGVIVARTDSEGASLTQKIPVSNEPGDLASQYIDFIEMEEVTLENAKEN
DSLLKHNGKLVRPVRLPNGLYQFREDTNIDRVVLDCVTALENGADLLWIETPTPDVEHIK
MMVDRIKEQQPKAKLVYNNSPSFNWTLNFRKQIIAQWEEEGKDLSAYNKNDLMSADYDGT
ELDTAADEAARNFQRDAAREAGVFHHLITLPTYHTTALSVHELAKGYFGEDGMLAYAAGV
QRKEIREGIACVKHQAMAGSDLGDDHKEIFSGEHALKAGGGKNTMNQF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgcatataaatcagcgatcgatttagtacgtgaactaaaacaaaagcacggt
aactggcagaatatcagcgaaactgatgcggcacgtatgatgtcacaaaaccgtttcaaa
acaggtttggatatcgctaagtacacggcaaaaatcatgcgtcaagacatggaagaatat
gacaatgatacgtctcaatacacccagtctctaggtgcatggcatggttttgttgcacag
caaaccatgtatgcgaagaaaaaatactttggcacgacgtctaaaacttacatctaccta
tctggttggatggtagctgccctacgttctgagtttggtcctctgcctgaccaatctatg
cacgaaaaaacgtcagtacctaagcttatcgcagagatctacactttcttgcgtcaagct
gatgcaaaagtattgaacgattatttccgcgagctaaatgcagctgaagaagcaggtcaa
gatacctcagctattttagaaaaaatcgaaaactttgattcacatgttgtgccaatcatt
gctgatatcgatgcaggtttcggtaacgaagaagcaacttacttgctcactaagcaaatg
atcgaagcgggtgcttgtgctatccaggttgaaaaccaagtatctgacgctaagcaatgt
ggtcaccaagcgggtaaagtaactgtaccgcacgaagactttatctctaaaatcaacgcg
attcgttatgcattcttagagcttggtgttgaagacggtgttatcgttgctcgtactgac
tctgaaggcgcgtcactcacgcaaaagatcccagtatcaaatgagccaggcgaccttgct
tctcaatatatcgattttatcgaaatggaagaagtgacgctagaaaatgcaaaagaaaac
gacagcttgcttaagcataacggcaaactagtacgtccagttcgtttgcctaatggtcta
tatcagttccgtgaagacaccaacatcgaccgcgttgtacttgactgtgtaactgctcta
gaaaacggtgccgatctactatggatagaaacacctactccagacgttgaacacatcaaa
atgatggttgatcgtattaaagagcagcagccaaaagccaagcttgtatacaacaacagc
ccgtcattcaactggacgttgaacttccgtaagcaaatcatcgctcagtgggaagaagaa
ggtaaagacctatctgcctacaataaaaatgacttgatgagtgctgattacgacggtact
gaacttgatacagcagctgacgaagcggctagaaacttccaacgtgatgcagcacgtgaa
gcgggtgtattccatcacttaatcacgctacctacttaccacaccactgcacttagcgtg
catgagcttgctaaaggctacttcggtgaagatggtatgcttgcttatgcagctggcgtc
caacgtaaagaaatccgcgaaggcatcgcttgtgttaagcaccaagcaatggcgggttct
gaccttggcgatgaccacaaagagatcttctctggtgaacatgcccttaaagctggcggc
ggcaagaacaccatgaaccagttctaa

DBGET integrated database retrieval system