KEGG   Psychrobacter arcticus: Psyc_1643Help
Entry
Psyc_1643         CDS       T00256                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
par  Psychrobacter arcticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyc_1643
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psyc_1643
   00630 Glyoxylate and dicarboxylate metabolism
    Psyc_1643
Enzymes [BR:par01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psyc_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031762..2033966)
Genome map
AA seq 734 aa AA seqDB search
MSQSSNANRVQKGILAIDQQLFDFIENEVLPKVGIDSDGYWSGFEKVIKEFTPRNKALLA
TRDNIQAKIDQWHLQHPAKNGDIDYPVYKAFLQEIGYLLPEGEAFSVSTENVDDEIALIA
GPQLVVPVRNARYALNANNARWGSLYDALYGTNVISDENGQEAKGGYNPTRGAAVVAYAK
NFLDENFTLASGSYSDVTGFKVVDGKLEIAQGDSSTQLKNAAQFAGFVGDASSPSAVLVK
NNNLHAEIQIDSNHPIGKDDPANIKDVLLESALTAIQDCEDSIAAVDAEEKVEAYRNWFG
LMNGDLQETFEKGGKTRTRKQNPDRKYTTPEGDTLTLPGRALLLLRNVGHLMQNPSILVD
LGNGQEEVFEGLMDALITPLLSLNDLNGKTELSNSRKGSMYIVKPKMHGPDEVKMANDLF
NASEDLLGLERHTIKIGIMDEERRMTVNLKEAIRQAKERVIFINTGFLDRTGDEMHTSMN
AGPFVRKDDMKSQTWLLAYEQRNVDIGLEVGLQGHAQIGKGMWAKPDEMQEMMDTKIAHP
KSGANTAWVPSPTGATLHSMHYHQVNVAEVQDSLKSRTRASVDDILTIPLAKNTNWTEKE
KQQEIDNNAQGILGYVVRWVNQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLHHNVV
SEQQVMDAMKRMAKIVDEQNADDADYQPMATDFDNSYAFKAACDLVFKGREQPSGYTEPL
LHQARLDLKASIGC
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtcttctaatgccaatcgcgttcaaaaaggcattcttgccattgatcagcag
ctgttcgattttatcgaaaatgaagtgctgccgaaagtcggtattgattcagacggttat
tggtcaggttttgaaaaggtcattaaagagtttacgccacgtaataaagcgctgcttgca
acccgcgataatattcaagcgaaaattgaccaatggcacctgcaacaccctgccaaaaat
ggcgatattgattatccagtgtataaggcatttttacaagaaattggttatctcttacca
gaaggcgaagcgttcagcgtcagcacagaaaacgtcgatgatgagattgcactcattgca
ggaccgcagttggtagtgccagtacgtaatgctcgttatgctttgaatgccaataatgcg
cgttggggcagcttatatgatgctttatatggcaccaatgttatcagtgatgaaaatggt
caagaagcgaaaggcggttataacccaacacgcggcgctgcggtcgtcgcttatgccaaa
aatttcttagatgaaaactttacgctagcatcaggatcatatagcgatgtaactggtttt
aaagtggtcgatggcaagcttgaaattgctcaaggtgatagcagcacgcagctgaaaaat
gccgcacagtttgcaggtttcgttggcgatgccagcagtcctagcgctgtattagtaaag
aacaacaacttgcatgctgagattcaaattgatagcaatcatcccattggtaaagatgat
cctgccaatatcaaggacgtcttattagaatcagcgctgaccgcgattcaagattgtgaa
gactcaattgctgctgtcgatgccgaagaaaaggttgaggcttatcgcaactggtttggc
ttaatgaacggcgatttgcaagaaacctttgagaaaggcggtaaaacccgcacccgtaaa
caaaatcctgatcgcaaatataccacgccagagggtgatacgctgaccttgccaggtcgc
gcgctcttattgctgcgtaacgtcggtcatctcatgcaaaatccatcgattttggtagat
ttgggcaatgggcaagaagaagttttcgaaggtttgatggatgctttgattacgccttta
ttatcattaaatgatttgaacggtaaaactgagctatcaaactcgcgtaaaggctcgatg
tatatcgtcaaaccaaaaatgcatggtccagacgaagtgaaaatggcgaatgacttattt
aacgcctcagaagatttattgggcttagagcgtcatactataaagattggcatcatggat
gaagagcgtcgtatgacggtcaacttaaaagaagccatccgccaagcaaaagagcgggtt
attttcatcaatactggctttttagatcgtaccggtgatgagatgcacaccagtatgaat
gcaggtccatttgtccgcaaagacgatatgaagtcgcaaacgtggctactagcctatgag
cagcggaacgtcgatatcggtctggaagtaggtctacaaggtcacgctcagattggtaaa
ggcatgtgggcaaaacctgacgagatgcaagagatgatggacaccaagattgcccatcca
aagtcaggtgccaatactgcgtgggtaccgtcaccaacgggagcgaccttgcacagcatg
cactatcatcaagtcaatgtcgctgaggttcaagacagcctaaagtcacgtacgcgcgca
agcgtagatgatatcttgaccattccattggcaaaaaacaccaattggactgagaaagaa
aagcagcaagagattgataataatgctcaaggcatcttaggctatgtcgtacgctgggtg
aaccaaggcgttggttgttccaaagtccctgatatcaatgatgtgggcttgatggaagac
cgtgcgacgttgcgtatctcaagtcagcatatcgccaattggttacatcataatgtggtc
agcgagcagcaagtgatggacgctatgaaacgtatggcaaaaatcgtcgatgagcaaaac
gctgatgatgctgattatcaaccgatggcgactgactttgacaattcctatgctttcaaa
gccgcctgcgatttggtgtttaaaggtcgcgagcagccaagtggctatactgagccgtta
ttgcatcaagcgcgtctggacctaaaagccagcatcggctgctaa

DBGET integrated database retrieval system