KEGG   Psychrobacter arcticus: Psyc_1677Help
Entry
Psyc_1677         CDS       T00256                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
par  Psychrobacter arcticus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Psyc_1677
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psyc_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2075468..2075923)
Genome map
AA seq 151 aa AA seqDB search
MSMVNKYQLGAMLAAALLLSACEKTPPDYRAPVTLPLYTEGDADNGALIYQDACGQCHQL
NPGLNKKGPQLMNIYGAPAAELADYTYSEGLKASGWVWDAQTLDTYITDAEKAMPDSKML
SDPMPDAEERADVIAYLSTLRAAAPIVEDDK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctatggtcaataaatatcaactgggcgctatgcttgccgccgctttgctgctaagt
gcttgtgagaaaacaccccctgattatcgcgctcctgtcacgctaccgctttatactgaa
ggcgatgccgataatggtgcactcatatatcaagatgcttgtggtcagtgccatcagtta
aaccctggtctcaataaaaaaggcccgcagctgatgaatatttatggcgcgccggcagct
gaacttgcagattatacttatagtgaaggactaaaagcgtcaggttgggtttgggatgct
caaacgcttgatacttatattaccgatgctgaaaaagccatgccagactcaaaaatgctg
tcagatccgatgccagatgctgaagagcgtgctgatgtgattgcctatttgtctaccctt
cgcgcagctgccccgatcgttgaagatgataaataa

DBGET integrated database retrieval system