KEGG   Psychrobacter arcticus: Psyc_1677Help
Entry
Psyc_1677         CDS       T00256                                 

Definition
(GenBank) cytochrome C2
  KO
K08738  cytochrome c
Organism
par  Psychrobacter arcticus
Pathway
par01100  Metabolic pathways
par01120  Microbial metabolism in diverse environments
par02020  Two-component system
Brite
KEGG Orthology (KO) [BR:par00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psyc_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AAZ19525
UniProt: Q4FR33
Position
complement(2075468..2075923)
Genome map
AA seq 151 aa AA seqDB search
MSMVNKYQLGAMLAAALLLSACEKTPPDYRAPVTLPLYTEGDADNGALIYQDACGQCHQL
NPGLNKKGPQLMNIYGAPAAELADYTYSEGLKASGWVWDAQTLDTYITDAEKAMPDSKML
SDPMPDAEERADVIAYLSTLRAAAPIVEDDK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctatggtcaataaatatcaactgggcgctatgcttgccgccgctttgctgctaagt
gcttgtgagaaaacaccccctgattatcgcgctcctgtcacgctaccgctttatactgaa
ggcgatgccgataatggtgcactcatatatcaagatgcttgtggtcagtgccatcagtta
aaccctggtctcaataaaaaaggcccgcagctgatgaatatttatggcgcgccggcagct
gaacttgcagattatacttatagtgaaggactaaaagcgtcaggttgggtttgggatgct
caaacgcttgatacttatattaccgatgctgaaaaagccatgccagactcaaaaatgctg
tcagatccgatgccagatgctgaagagcgtgctgatgtgattgcctatttgtctaccctt
cgcgcagctgccccgatcgttgaagatgataaataa

DBGET integrated database retrieval system