KEGG   Psychrobacter arcticus: Psyc_1904Help
Entry
Psyc_1904         CDS       T00256                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
par  Psychrobacter arcticus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:par00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:par00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2352430..2353698)
Genome map
AA seq 422 aa AA seqDB search
MDQFLITGSSRIAGEVTISGAKNAALPLLAAMILAETPTTLHNVPSLQDVRTLIELIGGM
GIKIQKQGDTVTCDTKSIDNFYAPYDLVKTMRASILVLGPLLARFGEAEVSLPGGCAIGS
RPVDQHLKAFEAMGASITVENGYVIAQAPKGGKLLGCKFSFDMVTVGGTENVIMAAALAK
GTTVLGNCALEPEVVDLANMLVAMGAKISGIGTAIMTIEGVERLHGCEYAVVPDRIETGS
YLAGALMTGGDVLTKNTSALLLTPVLEKFEDMGAIITSGDDWIRAQMKGRPKAVDIRTQP
HPGFPTDMQAQVMAIACLADGTSTFIENIFENRYMHVPELNRLGASIQVDGHTAVVKGVE
CFTAAPVMATDLRASMSLVMAAAAAEGESLIDRIYHIDRGYEHVEKKLRALGVNIERINS
ND
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatttttaatcactggtagtagtcgtatcgcaggggaagtcaccatctcaggc
gccaaaaatgccgccttgccattacttgcggcaatgatattggctgagacgccaacgaca
ttgcataatgtgccatcgttacaagatgtgcgcacgttgattgagttgatcggtggcatg
ggtatcaaaatccaaaagcaaggtgataccgtcacttgtgataccaaaagtatcgataat
ttttatgcgccctatgatttggtcaaaacaatgcgcgcgtcaatcttagtactgggtcca
ttgctggcacgttttggtgaggcagaagtgtccttgccaggtggctgtgcgattggttcg
cgccctgttgatcagcatctgaaagcctttgaagcgatgggtgctagtattacggtagaa
aacggctatgtgatcgcgcaagcgccaaaaggcggcaagctgttagggtgtaagttctca
tttgacatggtgacggtaggcggtactgaaaacgttatcatggcagcagcacttgccaaa
ggcacaactgttttgggtaactgtgcgcttgagccagaagtggtagatttggccaatatg
ctggtcgccatgggtgctaagatcagtggtattggtacagcaatcatgactattgaaggc
gttgagcgtttgcatggttgtgagtatgcagtcgtgccagatcgtatcgaaacaggctct
tatcttgctggcgctttgatgacaggtggtgatgtattgaccaaaaacacctcagcacta
ctattaacccccgtgctagaaaaatttgaagacatgggtgcgatcattactagcggtgat
gattggattcgcgcacaaatgaagggtcgaccaaaagctgtcgatatccgcacccagcca
catccaggctttccaacggatatgcaagcacaggttatggcgattgcctgtcttgctgat
ggcaccagcacctttatcgaaaatatctttgaaaatcgctatatgcacgtccctgagctt
aaccgcttaggtgcctctatccaagtagatggtcatactgctgtcgtgaaaggggttgag
tgctttaccgccgcgcctgtaatggcaactgatttgcgcgcttcgatgtcactagtgatg
gcagctgcagcggcggaaggcgagagtttaattgaccgcatttaccatatcgaccgtggc
tacgagcatgttgaaaaaaaactgcgtgcacttggcgtgaatatcgagcgtatcaatagc
aatgattaa

DBGET integrated database retrieval system