KEGG   Psychrobacter arcticus: Psyc_1910Help
Entry
Psyc_1910         CDS       T00256                                 

Gene name
pfkB
Definition
carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
par  Psychrobacter arcticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psyc_1910 (pfkB)
Enzymes [BR:par01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Psyc_1910 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2358027..2359046
Genome map
AA seq 339 aa AA seqDB search
MYDVMAIGNALVDHEYLLSDAALEETDLTKGHMTLAGIEEQQQLLAYFKLAEIEPSKQAG
GGSAANAMVAFSSLGGKPFYACRVGDDKQGEFYLKDLHEAGVTTSPQSIHAGGVTGSCVV
AVTEDGERTMQTFLGTSSDITADNVDFNALTQAEWLYLEGYLAMSAGIQPAMDQLRQQAG
VNGAKIAVSFADPAVVKFAKDGLLNMLGNKVAMIFCNSEEARLFTDETQYKSAARALLQH
CQTAVVTDGANGAVIAHQPNDESDIEIYDIPTPAVDNVIDTNGAGDNYAGAFLYALSQQY
SLPECGHLASAVAAQVIQQFGPRLASKDYQDIAKRVLSA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatgtgatggcgataggtaatgccttggttgaccacgagtatctgttatcagat
gccgccttagaagaaactgacctgactaaaggtcatatgacgctggcaggcattgaagag
caacagcaattattggcgtattttaagcttgcagagattgagccatcaaaacaagcgggc
ggcggctcagctgccaatgccatggtcgcattttcaagtttgggcggcaaacctttttat
gcctgccgcgtgggtgatgataagcaaggtgagttttatctaaaagacttgcatgaagca
ggtgttaccacctcacctcagtccattcatgcaggcggtgtaacaggttcgtgcgtggtt
gcggtcactgaagatggcgagcgtaccatgcagacgttcctaggtacttcaagcgatatc
accgctgataacgttgactttaacgcgttaactcaagctgagtggttgtatttagaaggc
tatcttgcaatgtccgcaggcattcagccagcgatggatcaattgcgtcagcaagctggt
gtaaatggtgccaagattgccgtcagcttcgctgatccagccgttgtaaaatttgccaaa
gatggtttgcttaatatgctcggcaacaaggtggcaatgatattttgtaatagtgaagag
gcgcgtttattcacggatgaaacacagtataagtcagcggcgcgtgcgctacttcaacat
tgtcaaactgcggtcgttactgatggtgcaaatggggctgtgattgcccatcagccaaat
gatgagtccgacattgagatttacgatatccctacgccagcagtcgataatgttattgac
accaatggtgccggtgataactatgcaggcgcatttctatatgctttatcgcagcaatat
agcttgccagaatgtggtcatcttgccagtgcagtagccgcgcaagtgattcaacagttc
ggtccacgtttagcgtcaaaagattatcaagatatcgcaaagcgtgtgctgtctgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system