KEGG   Psychrobacter arcticus: Psyc_2113Help
Entry
Psyc_2113         CDS       T00256                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
par  Psychrobacter arcticus
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:par01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2611032..2611844
Genome map
AA seq 270 aa AA seqDB search
MINRLSRLPQRLLTVAALTVAIAISGCQKTPDADDTKTDTGTQDSTQTINQTSDTQLSQT
TPKTNSAEQQAPLTILALGDSLTEGLGVDNDANYPAQLQTRLQELGYKDIKVINSGLSGE
TSTGLVNRLDWVLQTKPDITILTIGANDAIRGIDVATVEANIRTAVKRLQDNDSVVILGG
MQIYDNLGSDYVKSFAAIYPRVAKDMNVTLIPFFLDGVGGDPKLNQADAIHPTKEGYTFI
VNDNILPILQPELKKINPSNVTNTPTETAQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgataaacagactttctcgcttaccgcagcgcttgctcacggtcgctgcattgactgtc
gcaatcgcaatcagcggttgtcaaaaaacgcctgatgccgatgatactaagacagatact
ggcactcaagacagcactcaaaccatcaatcaaacctctgatactcaactatctcaaacc
acacctaagacgaactctgctgaacaacaagcacctttaaccatattggcattaggtgac
tcgttgacagaagggcttggggtggataatgatgccaattaccctgctcagctacaaaca
cgtttgcaggaacttggttataaagacatcaaagtcatcaattcaggattaagcggcgag
accagcacaggtttggtcaatcgattagattgggtattacagaccaaacctgatatcact
attttgaccattggtgccaatgatgctattcgtggtatcgatgtcgcgacggttgaagcc
aatattcgtactgccgtaaagcgcttacaggacaatgatagcgtggtcatcttaggcggt
atgcagatctatgacaaccttggctctgattacgtaaaatcctttgcggcaatatatcca
agagtggcgaaagacatgaacgtgacgctcattccgttctttttagacggtgtaggcggc
gatcctaagctcaatcaagcggatgccattcatccaaccaaagaaggttatacgtttatc
gttaatgacaatatcttgccgatattgcagcctgagcttaaaaaaataaatccatcgaat
gtgaccaacacgcctactgagactgcacaatga

DBGET integrated database retrieval system