KEGG   Psychrobacter arcticus: Psyc_2137Help
Entry
Psyc_2137         CDS       T00256                                 

Gene name
thrC
Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
par  Psychrobacter arcticus
Pathway
par00260  Glycine, serine and threonine metabolism
par00750  Vitamin B6 metabolism
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01230  Biosynthesis of amino acids
Module
par_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyc_2137 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psyc_2137 (thrC)
Enzymes [BR:par01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psyc_2137 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AAZ19984
UniProt: Q4FPS4
Position
complement(2638533..2639954)
Genome map
AA seq 473 aa AA seqDB search
MKYISTRGQTAPMDFSDVLLMGLAPDGGLMLPEHYPNIDSATLTEWRALSYPQLAMAIMQ
RFATDIPAADLQDIIERTYTADIFGSDEIVPVRKLEDDLYVLGLSNGPTLAFKDVAMQFL
GNAFEYVLKRKDACITIIGATSGDTGSAAEYALRGKENIEVFMLSPHGKMSEFQRAQMYS
LTDDNIHNIAIDGMFDDCQDIVKALQQDAEFKAAYNLGTVNSINWGRILAQIVYYFKAYF
AVTTSNDEKVSFSVPSGNFGNICAGHIAREMGLPVERLIVATNENDVLNDFFNQGAYQPR
PTAKTYITSSPSMDISKASNFERFVYLLLDKDSARVHELFEGVKSGQGFDLSDLMQAVNS
RYGFAAGKSTHSDRLQTIKTLYEQYGELVDPHTADGIKVAKELQQEGEVIICAETALPVK
FADTIVEAIGQIEIARPAHTEGLESLPQHVVVLDNDAELVAEQIRQQVTPNPT
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatcagtacccgtggtcagacagcaccgatggattttagtgatgtgttatta
atgggtcttgcaccggacggtggtttgatgttgcctgagcactatccaaacattgatagt
gcgacgcttactgagtggcgcgcgcttagctacccacagcttgcaatggcgattatgcag
cgctttgcgactgatattcctgccgctgatttacaagatattattgagcgcacttatacc
gctgatatatttggctctgatgagattgtccctgtccgcaagcttgaagatgatttatac
gttttaggcttatcaaatggtccaacgttggcattcaaagacgttgccatgcagttctta
ggcaatgcttttgaatatgtacttaaaagaaaagacgcgtgcatcaccattatcggagcg
accagtggcgatacgggtagtgcagcagaatatgcactgcgcggtaaagaaaacatcgaa
gtgtttatgctgtcaccacatggcaaaatgagtgaatttcagcgcgcacaaatgtatagt
ttaaccgatgataatattcataatattgccattgatggcatgtttgatgattgccaagat
attgtcaaagcactacaacaagatgcagagttcaaagcggcttataacttaggcacagtc
aattctattaattggggtcgtatcctagcgcagattgtttattactttaaagcctacttt
gcggtgactacgagcaacgatgaaaaggttagttttagcgtgccatcaggcaactttggt
aatatctgcgctggtcatattgcccgtgaaatggggttgcctgttgagcgtttaattgtc
gcgaccaatgaaaacgatgtcttaaacgacttctttaatcaaggtgcctatcagccgcga
ccgactgccaaaacttatatcacctcaagcccctcaatggatatttccaaagcgtccaac
tttgagcgttttgtctatctcttactagataaagacagcgcccgtgttcatgaattgttt
gaaggggtgaaatctggccaaggttttgatttgtctgatttgatgcaagcagtcaatagt
cgttatggttttgccgctggtaaatctacccatagtgaccgcttacaaaccattaaaaca
ctttatgagcaatatggtgagctggtcgatccgcataccgctgatggtattaaagttgcc
aaagaattgcagcaagagggtgaggtgattatttgcgctgagactgcacttccagtgaaa
tttgcggatactatcgttgaggccattggtcaaatagagattgcacgcccagcccatacc
gaaggcttagagagtttgcctcaacatgtggtggtgcttgataatgacgctgaattagtc
gctgaacaaatccgtcaacaggttacaccaaatcctacatag

DBGET integrated database retrieval system