KEGG   Pyrobaculum arsenaticum: Pars_0078Help
Entry
Pars_0078         CDS       T00503                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pars_0078
Enzymes [BR:pas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pars_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
73337..74245
Genome map
AA seq 302 aa AA seqDB search
MASIGNLNFDIYLRISELPGPDENIEALDLYTGGGGSAANFAVAVARMGLGARFIGAVGD
DPLGDISLRELLAEGVEVAVKRVTGVRSGVVVVLVHPDGIKRMVSFRGANLGLTPADLTL
DKFEGVNHIHLATGRTELITKAKEIAREVGASVSVDGGTALARKGLEIVRATVEGVDVVF
MNHVEAKMLANTGDHRSAVEKLAKELKVGELVVTLGPLGAVAYRGGKLLHVDAFKVAALD
TTGAGDSFAAAYIAMHLRGRDLYEKLLFANAAAAIKVTRPGARSSPRYDEVRSFLESLGY
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtctattgggaacctcaattttgacatatatctcagaatatccgagttgcccggc
cccgacgagaacatcgaggcgttggacttgtacactgggggcggaggctctgctgcgaac
ttcgccgtagcagtggctagaatgggcctaggcgccaggttcataggcgcagtcggcgac
gacccactgggagatatatcgctaagagagctcttggccgaaggcgtcgaggttgctgtg
aagagggtcaccggggttaggtcgggggttgtcgtcgttctcgtgcacccagacggtatt
aagagaatggtgtcgtttcgcggcgccaacctgggcctcaccccggcggacttgactctg
gacaagttcgagggtgttaatcacatccacttggccactggcaggactgagctgataacc
aaggcgaaggaaattgccagagaagtaggcgcctcggtgtctgtcgatggggggaccgca
ctggcgaggaaggggctggagatcgtgagggcgactgtagagggcgtcgacgtggttttt
atgaaccacgtagaggctaaaatgctcgccaacaccggcgatcatagatcggctgtggag
aagctggcaaaagagcttaaagtcggcgagctggtcgtcacgctgggcccccttggcgcc
gtagcatatagaggaggaaaacttctacatgtagatgctttcaaagtcgctgcgttggac
acaacgggggctggcgacagcttcgcggcggcgtatatagccatgcacctaagagggagg
gatttgtatgaaaagttgttattcgccaacgccgcggcggctattaaggtgacgaggccg
ggcgcccgctcgtcgccgaggtatgacgaagtccgctcttttcttgagtctcttgggtac
aagatttaa

DBGET integrated database retrieval system