KEGG   Pyrobaculum arsenaticum: Pars_0122Help
Entry
Pars_0122         CDS       T00503                                 

Definition
radical SAM domain-containing protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pas  Pyrobaculum arsenaticum
Brite
Enzymes [BR:pas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Pars_0122
Transfer RNA biogenesis [BR:pas03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Pars_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(109276..110727)
Genome map
AA seq 483 aa AA seqDB search
MERPLRFVRMASGVHVVALMTQPLPCPGRCAFCPTSADAPKSYMPDSPVVLRAKRNRYDP
YLQTAGRVKVYLENGHTPSKIEAVVMGGTFSALPRSYREWFVANVYKALNDYPHWAPAAD
PAPDLEAEQLRNETASLRLVALAVETRPDYVDGAEADFLLRLGVTRMELGVQSIYDDVLQ
RVKRGHGVAEVARATALLKDSAYKVCYHLMPGLPGSDPDRDLEMVKEVFSDPRFVPDCVK
IYPTYVVPGTELYDEWRRGAYRSYDEETWLELLAKIYASVPRWARVMRLGRDIPLHHVVD
GPRWGNMRQMVLRHMERLGLKCLEIRCREVGIKLANNVPIQPGPIEVKKTEYEASGGVEI
FLEAVGPDDTLYAILRLRIPGKPHRPELRKAALVRELHVYGPAVPVGEQGIWWQHTGLGR
GLMTRAEEIAREYGVLKIAVISGVGAREYYRKLGYSRCGPYMCKPIGALLGYADDYLAAS
ESI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcccctccgctttgtcagaatggcgagcggagtccacgtcgttgccctcatg
acacagcccttaccctgccccggccggtgcgccttctgcccgacctcggccgacgccccc
aagtcctacatgccggacagccccgtggtgctccgcgccaaaaggaataggtacgatccg
tacttacagacggcgggccgggtaaaggtgtatctcgaaaacggccacacgccctctaag
atagaggctgttgtgatgggcggcaccttcagcgcgttgccgcggagctaccgggagtgg
ttcgtcgccaacgtgtacaaggcgcttaacgactacccccactgggccccagccgccgac
cctgcccccgatcttgaggccgaacagctgaggaacgagacagcgtccctccggctggtg
gctctcgccgtggagaccaggccggactacgtggacggggccgaggcggacttcctcctt
aggctcggcgtcaccaggatggagctcggcgttcagtccatatacgacgacgttttgcag
agggttaagaggggccacggcgtggccgaagtggccagagccaccgcgcttctgaaagac
tcggcgtataaggtgtgctaccacctcatgcctgggctcccggggagcgacccagaccgc
gacttggagatggtgaaggaggtgttttcagacccccgcttcgtgccggactgcgtcaag
atataccccacctacgtggtgccggggactgagctctacgatgagtggcgccgcggtgct
tataggagctacgacgaggagacttggctggagctgttggcgaagatatacgcgtcagtc
ccccgctgggccagggtgatgaggcttggcagggacatccccctccaccacgtcgtggac
ggccccaggtggggcaacatgcggcagatggtgctgaggcacatggagaggctgggccta
aagtgcctggagattaggtgcagagaggtgggcataaagctggcaaacaacgtgccgatc
cagccgggccccatcgaggttaagaagacggagtacgaggcctcagggggcgtggagata
tttctagaagccgtcggcccagacgacaccctatacgcaattctgcggctgaggatcccc
ggcaagccgcataggcctgagctacgcaaggcggcgcttgtgagggagctccacgtctac
ggccccgccgtacccgtgggggagcagggcatttggtggcaacacacaggcctcggcaga
ggcttgatgacccgcgccgaggagatcgccagggagtacggcgtgttgaaaatcgcggtt
atctccggggtcggggcgagggagtactaccgcaagctgggctacagcagatgcggcccc
tacatgtgcaagcccataggcgcgctgctcggctacgcagacgactacctcgccgcaagc
gaaagtatttaa

DBGET integrated database retrieval system