KEGG   Pyrobaculum arsenaticum: Pars_0141Help
Entry
Pars_0141         CDS       T00503                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_0141
   01230 Biosynthesis of amino acids
    Pars_0141
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0141
   00030 Pentose phosphate pathway
    Pars_0141
   00051 Fructose and mannose metabolism
    Pars_0141
  Energy metabolism
   00680 Methane metabolism
    Pars_0141
Enzymes [BR:pas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pars_0141
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Pars_0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(129917..131137)
Genome map
AA seq 406 aa AA seqDB search
MRLITTLMKVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGAIIDYFVYNVGDD
ISLLMTHTKGEDNPEIHGLAWETFKEITEQIAKKFKLYGAGQDLLKDAFSGNVRGMGPQV
AEMEFEERPSDPLIVFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMHEGFIFEVLDV
VEHKVYLLKTPEEAYSLLGLIGTTGRYIIRKVFRKADGAPAAANSVERLSLIAGRYVGKD
DPVMMVRAQSGLPAVGEILEAFAHPHLVHGWMRGSHAGPLMPARFISIDPEKRIAIGAKM
TRFDGPPKVGALGFQLHDGYLEGGVDLFDDPAFDYVRQVAAQIADYIRRMGPFQPHRLPP
EEMEYTALPKILAKIKAYPADKYEKERRKYIEAIVKGEKVGESQHD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatcacaacactcatgaaagtaaccgtatcaataatcaaggccgacgtcggc
ggcttcccgggacatgcccacgtccatccaaaaatgcttgaatacgccgcggcgaagcta
aaagaggcgcaaaagaggggggccatcatcgactattttgtctacaacgtcggcgacgac
atatcgctgctcatgactcacacaaaaggcgaggacaaccccgagatacacggtctcgcc
tgggagactttcaaggagatcacagagcaaatagcgaagaagtttaagctctacggggct
ggccaagacttgttgaaagacgccttctcaggcaacgtaagaggaatggggccgcaagtc
gcagaaatggagtttgaagaaaggccgagcgacccgttaattgtatttgcagcagacaag
acagagcccggcgcattcaacctcccgctgtataagatgttcgcagacccgttcaacaca
gcggggctcgtaatagatccatcaatgcacgaaggctttatcttcgaagtcctagacgta
gtggagcacaaggtctacctattaaagacgccagaggaggcctactcgttactgggctta
ataggcaccactgggaggtatattattaggaaagtcttcagaaaagccgacggcgcgccg
gccgctgcaaatagcgtcgaaaggctctctctaattgccgggagatatgtcggcaaagac
gacccagtgatgatggttagagcccagtcggggctccccgctgttggagaaattcttgag
gccttcgcacatccacacctcgtccacgggtggatgcgcggctcgcacgcaggtccgctt
atgccagcgcgcttcatttccatagatcccgaaaagagaattgccataggcgccaaaatg
acccgcttcgatggaccgcccaaagtcggcgccctaggcttccagctacacgacggatac
ttagaaggcggcgttgacctattcgacgacccggcctttgactacgttaggcaagtcgcg
gcccaaatagcagattacatacgcagaatggggcccttccagccacaccgcctcccacca
gaagaaatggagtacacagccctgcctaaaatcttggcaaaaattaaggcctaccccgcc
gacaagtacgaaaaagagagaagaaaatacatcgaggccatagtaaaaggagaaaaagta
ggggagtctcaacacgactaa

DBGET integrated database retrieval system