KEGG   Pyrobaculum arsenaticum: Pars_0195Help
Entry
Pars_0195         CDS       T00503                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pars_0195
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0195
   00020 Citrate cycle (TCA cycle)
    Pars_0195
   00620 Pyruvate metabolism
    Pars_0195
   00640 Propanoate metabolism
    Pars_0195
   00650 Butanoate metabolism
    Pars_0195
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_0195
   00680 Methane metabolism
    Pars_0195
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pars_0195
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pars_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
173735..174916
Genome map
AA seq 393 aa AA seqDB search
MMQVQKTKHIEALTTNYAVAYAVKAADVDVIAVYPITPQTTIVEKISEFVANGELNAELI
HVESEHSALSAVVGAAATGARVFTATSSQGLELMHEVLHIAAGMRLPIVMAVPSRTLSAP
ISIHGDYSDLMNARDTGWVIYIAASAQEAYDTVIQAFRLAESVSLPVMVSYDGFLMSHTV
EPVELNDEEEVRKFLPRAVRPYTLNPKRPVTMGPLASPDWYYEFKYQQVLALKEAYKVAK
EVDSEYGRRFGRSYGVVETYRMEDADYAIVAYGGASYGNARAAADLARKRGIAAGVVRVR
LYRPFPTADVLKALDGVKAFAVVDRAIMFGSPAEGPLYKDIATAMYMHGIDKPALGVIHG
IGQRTMYVEDMYKIYTMLRENPRKEVVFLGVRV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggtccaaaaaaccaaacacatagaggcccttacaaccaactacgccgtggca
tacgccgtaaaggcggcggacgtagacgtaattgcggtatatcccatcacgccgcagacc
accatcgttgagaagatctccgaatttgtcgcaaacggcgagctaaacgccgagctcatc
cacgtagaaagcgagcactccgccctctccgcggtggtgggcgccgccgctacgggggcc
agggtcttcaccgccacctccagccaaggcctcgagctgatgcacgaggtgttgcacatc
gccgcaggtatgaggctaccgattgtgatggcggtgccctctaggaccctatcagcgccg
attagcatacacggcgactacagcgacttgatgaacgcaagagatacaggctgggtcatc
tacatcgccgcctcggcccaagaggcatacgacacggtgatacaagcgttccgccttgca
gagtccgtgtcactacccgtgatggtgtcctacgacggcttcctcatgtcccacacagtg
gagccggtggagctcaacgacgaggaggaggtaaggaagttcctcccccgcgccgtgagg
ccctacaccctaaaccccaagcggccagtcactatgggcccactggcgtcgcctgactgg
tactacgagttcaaataccagcaagtcttggcgttgaaagaggcctacaaggttgctaag
gaggtggactccgagtacggccgccgcttcgggaggagctacggcgtcgtcgagacctac
cgcatggaagacgccgactacgccattgtggcctacggcggagcctcatacggcaacgcc
cgggccgcggcggacctagccaggaaaaggggcatcgccgcaggcgtggtacgcgtgagg
ctgtaccgccccttccccacagccgacgtcctcaaggccctcgacggcgttaaggccttc
gccgtggtggacagggcaataatgttcggcagccccgccgaaggtcccctatacaaggac
atagccacagccatgtacatgcacgggatcgacaagccagccctcggcgtcatacacggc
ataggacagcggactatgtacgtagaagacatgtacaaaatatataccatgctgagagaa
aacccaagaaaagaggtggtattcctgggggtgagggtatga

DBGET integrated database retrieval system