KEGG   Pyrobaculum arsenaticum: Pars_0196Help
Entry
Pars_0196         CDS       T00503                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas00010  Glycolysis / Gluconeogenesis
pas00020  Citrate cycle (TCA cycle)
pas00620  Pyruvate metabolism
pas00633  Nitrotoluene degradation
pas00640  Propanoate metabolism
pas00650  Butanoate metabolism
pas00680  Methane metabolism
pas00720  Carbon fixation pathways in prokaryotes
pas01100  Metabolic pathways
pas01120  Microbial metabolism in diverse environments
pas01130  Biosynthesis of antibiotics
pas01200  Carbon metabolism
Module
pas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pars_0196
   00020 Citrate cycle (TCA cycle)
    Pars_0196
   00620 Pyruvate metabolism
    Pars_0196
   00640 Propanoate metabolism
    Pars_0196
   00650 Butanoate metabolism
    Pars_0196
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pars_0196
   00680 Methane metabolism
    Pars_0196
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pars_0196
Enzymes [BR:pas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pars_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABP49811
UniProt: A4WHE4
Position
174913..175857
Genome map
AA seq 314 aa AA seqDB search
MKVYYKTLKDLPREELFAPGHRMCAGCGAAIAMRWITKTIGPNAIIANATGCVEVTTTPY
PETAWMHPYIHVAFENSAAVASGVEAAIKALRRKGLWDAGDTKVVVIAGDGGTYDIGLQS
LSGMLERRHGVLYILYDNEAYMNTGIQRSGSTPKFSWTTTTPVGTAVRGKIQWKKDIMGI
VMAHRVPYAATASISHILDMVNKIKTALEYTSEGPTFLHIFAPCVPGWRYPENKTVEVAR
LAVETGYFPLYEWDHGKLKLNPPSNAHLDKSKRRPLKEYLKLQGRFAHLTDEEIAELEKE
LDAYWEYLGKLAQL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctactacaaaaccttgaaagatctgccgcgggaggagctcttcgcgccgggt
cacaggatgtgtgctggctgtggcgcggcgatcgccatgaggtggattaccaaaacgatt
ggcccaaacgccataattgccaacgccaccggttgcgtcgaggtgacgactacgccttac
cccgagacggcgtggatgcacccctatatccacgtcgcctttgagaactccgccgctgtc
gcctccggcgtggaggcggcgataaaggcgctgaggaggaaaggcctctgggacgccgga
gataccaaggtggtcgtcatcgcaggagacggcgggacctacgacatcggcctccagtcc
ctcagtgggatgctggagaggagacacggcgtgttgtacatactatacgacaacgaggcc
tatatgaacacgggtatccagcgctcgggctctacacctaagttcagctggaccacgacg
acgccggtgggcacggctgtgagggggaagatccagtggaagaaggacataatgggcatc
gtgatggcgcacagagtgccctacgcggcgacggcctctatatctcatatactggacatg
gttaacaagatcaagacggcgctggagtacacctcggaggggcccacgttcttgcacatc
tttgcgccgtgtgtgccgggctggcggtacccagaaaacaagacggtggaggtggccagg
ctagcagtggagacgggctacttccccctgtacgagtgggaccacggcaagctgaagctc
aacccgcccagcaacgcccacctagacaagtcgaagaggaggccgttgaaagaataccta
aagctccagggaaggttcgcccacttgacagacgaggagattgccgagctggaaaaggag
ctagacgcctattgggagtacctgggcaagttggcgcagctctag

DBGET integrated database retrieval system