KEGG   Pyrobaculum arsenaticum: Pars_0206Help
Entry
Pars_0206         CDS       T00503                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pars_0206
Enzymes [BR:pas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pars_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
185245..186657
Genome map
AA seq 470 aa AA seqDB search
MLRGAGVLLHITSLPGGCYVGDLGPEAYKFAEFLAEAEQTYWQTLPINHSVPEYENSPYS
AVSSFAGDPKLISLDLMKREGLIDQVPDCPPAERVDYAAAWEVKKKALEKALRRGKKLSD
YKNFVESTPWLEDYAYYMAMRDLYGPWPKWPRRDPPGELVELYKFAQFVFWRQWRELKQY
VNSLGIFLIGDLPIYPSLDSADVWRHRRYFKITEDGAPLYVAGVPPDYFSPTGQLWGNPV
YNWEALRADGYRWWLDRLRHTLSAFDYVRLDHFRGYVAYWEVPAGEKTAVNGRWVPAPGA
ELLEKARSELGELRLIAEDLGYITPDVVELRDRLGFPGMRVLQFAWDGNPANEHKPHNHV
KNSVVYTGTHDNNTAVGWYLEEATPRARREFCQYAKCSAAEGVHWCFIRLAYMSVANVAI
VPIQDVLGLGSEARMNKPGTVGGNWRWRLAKMPNAAVRRRLRKLTRIYGR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgctacggggggcaggcgttttactccacataacttcactcccgggcggttgctacgtg
ggtgatctaggcccggaggcgtataaattcgccgagtttttagcagaggcggagcagacc
tactggcagacgctacctattaaccacagcgtgccggagtacgagaactctccctacagc
gccgtgtcgagcttcgcaggggatccaaaactgataagcctggacctcatgaagagggag
ggcctcatagaccaagtgccggattgtccccctgccgagagggtcgactacgccgcggcg
tgggaggtgaagaagaaggcgctggaaaaggcgctgaggaggggcaagaagctcagcgac
tacaagaacttcgtggagtccaccccttggcttgaagactacgcctactatatggccatg
agggacctctacgggccctggccgaagtggccgaggagagatccgccgggggagctggtg
gagctttacaaattcgcccagttcgtcttctggcgccagtggcgggagctcaagcagtac
gtaaacagcttgggtatattcttaataggggacctccccatataccccagcctagacagc
gccgacgtgtggagacacaggcggtacttcaaaatcacagaggacggcgcccccctctac
gtggccggcgtcccgccggactacttctcgccgactggccagctctggggcaacccagta
tacaactgggaagccttgagggccgacggttacaggtggtggctagaccggctgaggcac
acgctgtccgcatttgactacgtgaggctggaccacttccgcggatacgtggcctactgg
gaggtccctgccggcgagaagacggcggtgaacggtcggtgggtccccgcgccgggggcg
gagctactggaaaaagccaggtcggagctgggggagcttaggctaatcgcagaggacctc
ggctacataacgccagacgtggtggagctgagagaccgcctcggcttccccggcatgcgt
gtcttgcagttcgcctgggacggcaaccccgcaaacgagcacaagccacacaaccacgtc
aaaaactccgtggtgtacaccggcacccacgacaacaacacggcggtggggtggtatcta
gaagaggcgacgccgagagcgaggcgggagttttgccagtatgcgaagtgctcagccgcg
gagggcgtacactggtgtttcatcaggctggcctacatgtcagttgccaacgtagcgatc
gtgcctatacaagacgtgctgggccttggtagcgaggcgcggatgaacaagccaggcaca
gtggggggtaactggaggtggaggctggcaaagatgcccaacgccgccgtgaggaggcgg
ctgagaaaactaacccgcatatacgggcgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system