KEGG   Pyrobaculum arsenaticum: Pars_0353Help
Entry
Pars_0353         CDS       T00503                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pars_0353
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pars_0353
Enzymes [BR:pas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pars_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
302844..303341
Genome map
AA seq 165 aa AA seqDB search
MFPDARGFFAELWKRGEYLAAGLPYDFVQANLSFSKQYVVRGLHYQLKPSEQGKLVTVVK
GRVLDVAVDIRRGSPWYGRYVAVELEPGVALWIPPGFAHGFQALEETLFLYLVTKEYDQQ
RERCIGWDDPEIGIRWPAHDKAILSEKDAKCPPLKEAEDNFEYPI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagacgctaggggcttcttcgccgagctttggaagcggggggagtacttagcg
gccgggcttccctacgacttcgtccaagcgaacctctcgttctctaagcagtacgtcgtt
aggggcctacactaccagctgaagccctccgagcaggggaagctggtgactgtggtgaag
gggcgggtgctggacgtggctgtggacatccggaggggctccccctggtacggccgatac
gtggctgtggagctcgagccgggcgtcgccctctggatcccgccaggcttcgcccacggc
ttccaagccctagaggagacgctcttcctatacctagtcacgaaggaatacgaccagcag
agggagagatgcatagggtgggacgaccccgaaatagggataaggtggccagcccacgac
aaggccatcctaagcgaaaaagacgccaaatgcccaccgctcaaggaagccgaagacaac
tttgaatacccgatataa

DBGET integrated database retrieval system