KEGG   Pyrobaculum arsenaticum: Pars_0452Help
Entry
Pars_0452         CDS       T00503                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pas  Pyrobaculum arsenaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pars_0452
Enzymes [BR:pas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pars_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(394949..396037)
Genome map
AA seq 362 aa AA seqDB search
MEDFVQLLKKLSEARGPSGFEDEVREVVIREMEPYVDEVVVDKWGNVIGVKRGSSDYRAM
VAAHIDEIGLVVDHIEKEGYLRFRPIGGWNEVTLVSQRVWVRTSDGRWIRGVVGSLPPHV
TPSGREREAPEIKDLYIDIGVYSREEAEKLGVTVGSVVVLDREFAVLNGKVVTGKAFDDR
VGVAVMLYALRMLEKLPVTLYAVATVQEEVGLRGASVAAERINPHYALALDTTIAADVPG
VGERLHVTKLGKGPAIKVLDGGRGGLFIAHPGLRDHIVKLARELGIPYQMEVLYGGTTDA
MAIAFRREGVPAAVISVPTRYIHSPVEVLDVEDAVNAAKLLKATLERTTPEIVEKFLDKR
VK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaggacttcgtacagcttttgaaaaagctctcggaggcgagggggccgtcgggcttt
gaggacgaggttagagaggttgtaataagggaaatggagccttatgtggacgaggtagtt
gtggataagtggggcaacgtcatcggggtgaagaggggttcctcagactacagggccatg
gtggcggcgcacatcgacgagatcggactcgtcgtggaccacatagagaaggagggctac
ctgagattcagaccaattggagggtggaatgaggttactctcgtcagccagcgggtctgg
gtgaggacttcagatggccggtggataagaggggttgtggggtctctgccgccgcatgta
acgccgagcgggagggagcgcgaggcgcctgagattaaggacttgtatatagacatcggc
gtgtatagcagagaggaggcggagaagctaggcgtcaccgtcggatctgtggttgtgctg
gatagggaattcgccgtgttgaacggaaaggtggttaccgggaaggcgtttgacgacagg
gtgggagtagccgtgatgctctacgccttgaggatgctggaaaaactacctgtcaccctc
tacgccgtggcgaccgtccaggaggaggttggactccgcggggcaagcgtcgctgcagag
cgaattaatccccactacgctcttgccttggacaccacaattgccgccgacgtgccgggc
gtgggggagaggctccacgtaactaagctgggcaagggcccggccataaaggtgctggac
ggcggtaggggcggcctattcatagcccacccaggtctgagggatcacatcgtgaagttg
gcgagggagctcggtattccctaccagatggaggttctttacggcggtaccaccgacgcc
atggccatagcctttaggagggagggcgtccccgccgctgttatctcggtgcctacgcgg
tatatccactccccggtagaggtgctcgacgtggaggacgctgtaaacgcggctaagttg
cttaaggcaacgctggaaaggactacgccggagatcgtggagaagtttcttgacaagaga
gttaagtag

DBGET integrated database retrieval system