KEGG   Pyrobaculum arsenaticum: Pars_0452Help
Entry
Pars_0452         CDS       T00503                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
pas  Pyrobaculum arsenaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(394949..396037)
Genome map
AA seq 362 aa AA seqDB search
MEDFVQLLKKLSEARGPSGFEDEVREVVIREMEPYVDEVVVDKWGNVIGVKRGSSDYRAM
VAAHIDEIGLVVDHIEKEGYLRFRPIGGWNEVTLVSQRVWVRTSDGRWIRGVVGSLPPHV
TPSGREREAPEIKDLYIDIGVYSREEAEKLGVTVGSVVVLDREFAVLNGKVVTGKAFDDR
VGVAVMLYALRMLEKLPVTLYAVATVQEEVGLRGASVAAERINPHYALALDTTIAADVPG
VGERLHVTKLGKGPAIKVLDGGRGGLFIAHPGLRDHIVKLARELGIPYQMEVLYGGTTDA
MAIAFRREGVPAAVISVPTRYIHSPVEVLDVEDAVNAAKLLKATLERTTPEIVEKFLDKR
VK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaggacttcgtacagcttttgaaaaagctctcggaggcgagggggccgtcgggcttt
gaggacgaggttagagaggttgtaataagggaaatggagccttatgtggacgaggtagtt
gtggataagtggggcaacgtcatcggggtgaagaggggttcctcagactacagggccatg
gtggcggcgcacatcgacgagatcggactcgtcgtggaccacatagagaaggagggctac
ctgagattcagaccaattggagggtggaatgaggttactctcgtcagccagcgggtctgg
gtgaggacttcagatggccggtggataagaggggttgtggggtctctgccgccgcatgta
acgccgagcgggagggagcgcgaggcgcctgagattaaggacttgtatatagacatcggc
gtgtatagcagagaggaggcggagaagctaggcgtcaccgtcggatctgtggttgtgctg
gatagggaattcgccgtgttgaacggaaaggtggttaccgggaaggcgtttgacgacagg
gtgggagtagccgtgatgctctacgccttgaggatgctggaaaaactacctgtcaccctc
tacgccgtggcgaccgtccaggaggaggttggactccgcggggcaagcgtcgctgcagag
cgaattaatccccactacgctcttgccttggacaccacaattgccgccgacgtgccgggc
gtgggggagaggctccacgtaactaagctgggcaagggcccggccataaaggtgctggac
ggcggtaggggcggcctattcatagcccacccaggtctgagggatcacatcgtgaagttg
gcgagggagctcggtattccctaccagatggaggttctttacggcggtaccaccgacgcc
atggccatagcctttaggagggagggcgtccccgccgctgttatctcggtgcctacgcgg
tatatccactccccggtagaggtgctcgacgtggaggacgctgtaaacgcggctaagttg
cttaaggcaacgctggaaaggactacgccggagatcgtggagaagtttcttgacaagaga
gttaagtag

DBGET integrated database retrieval system